#cravings

It’s been such a long time since I’ve been to cafe101houston 😅 It’s such a cool place to go to for some cocktails/sake/beer or milk tea and tons of delicious food! They’re open till 2 am so it’s perfect for that late night cravings 😋😋 They got literally almost any food you would crave 🤤 Sushi, snacks, rice dishes, noodles, hot pot, etc. 📍 Cafe 101 9889 Bellaire Blvd 📝 Sizzling Kalbi beef 🥩 . . . . . . . . . . . . . . . . . . asianfood asianfoodporn asianfoods foodvideos foodvideo foodvid foodvids sizzling sizzlingplate beef beefribs beefmaster houstonrestaurants houstonfood houstonfoodies houstonfoodie houstonfoodblogger houstoneats yougottaeatthis tasty tastyfoods tastemademedoit yum yumyum yummy cravings


0💬Normal

When you found out that your favourite havmor eatery is now hoccoeatery , isn't it amazing?😍 - In frame- AMDAVADI PIZZA💜✨ - What's the pizza with our amdavadi twist perfectly presented by the fav of all our hocco eatery! It's our basic desi filling with the all time favourite Amul cheese and presented in a well baked pizza😍. Oh god m sure you all will definitely love it! - This is now basically a food brand selling some amazing variety of food items and their classic ice-creams!💙 - Thanks for inviting~ theopenslateofficial_ 🌸 - pizza cheese dinner cravings ahmedabadfoodblogger ahmedabadblogger foodblooger foodie instafood food ahmedabadbloggers jorrfood ahmedabadfoodies foodinahmedabad whatahmedabadeats foodphotography ahmedabadinstagram foodhall foodtalkindia amdavadi zingyzest foody trendinginahmedabad ahmedabadfood  hungrito foodiess_hub


2💬Normal

Bedmi Kachori Thali 😍🤤 Homemade food is indeed bliss🥰 AGREE ? 🙈😋 •• On plate- Rasse wale Aloo, Saunth, Dahi Bhalla, Dry fruit Kheer, Gobhi sabzi, Sitaphal/Kashifal/Kadoo ki subzi, Moolikass aur BEDMI KACHORI ♥️♥️🤤🤤🤤 - - - 🙏🏻 Do not waste water and food. 🙏🏻 • 🙏🏻 Do not litter on mountains & around you 🙏🏻 - 🚫 Seek Permission before reposting 🚫 - - - indiapictures indianfood delhi foodbeast delhidiaries indiansweets delhifoodblogger mumbaifoodie foodtalkindia comfortfood indianfoodie indianfoodbloggers foodmaniacindia mumbaifood foodphotography foodbloggers getinmybelly eatlocal eatfamous desifood eatclean eathealthy northindianfood delhifoodies nyceats delhifoodguide southindianfood cravings soulfood thali


1💬Normal

Not one to really care who holds what opinion because I feel if your too busy always caring you can't really move forward and some people will never have the positive opinion anyway. I just do what I feel is right and what I think is beneficial for myself and for all around me. positivequotesquotespositivitymoodthoughtofthedayinstamoodcareopinionsfoodiefoodlovefoodphotographysimplefoodsimplecookingcookinglovetocookcookwitheasecravingssimplekichenkitchenlovehomelifecookathomeeasyfoodeasycooklovewhatyoueatfoodstagrampakistanifoodgarnieroliaredheadmaybellinemaybellinetattoobrow


0💬Normal

Today’s Flavored Coffee Experiment: A blend of 3 rich coffee bean varieties, a drizzle of vanilla paste, red pepper flakes, crushed pecans, fresh sage, xocolatlchocolate pure Cacao dark chocolate sweetened with epichoneycompany mangrove honey! OurAbodeFTW OurAbode fortworthfoodie fortworthfoodies fwfoodie fortworthfoodster fortworthfood ftworthfood foodie foodies tasty delicious foodstagram foodphotography foodporn cravings vegandelights vegan vegancooking tasteofvegan earthfriendly foodislife practicinggourmet gourmetwannabe love2cook loveofcooking loveoffood foodlove foodfoodfood food


0💬Normal

Chicken tamales with red sauce glutenfree notlowcalorie cravings


0💬Normal

Today’s Flavored Coffee Experiment: A blend of 3 rich coffee bean varieties, a drizzle of vanilla paste, red pepper flakes, crushed pecans, fresh sage, xocolatlchocolate pure Cacao dark chocolate sweetened with epichoneycompany mangrove honey! OurAbodeFTW OurAbode fortworthfoodie fortworthfoodies fwfoodie fortworthfoodster fortworthfood ftworthfood foodie foodies tasty delicious foodstagram foodphotography foodporn cravings vegandelights vegan vegancooking tasteofvegan earthfriendly foodislife practicinggourmet gourmetwannabe love2cook loveofcooking loveoffood foodlove foodfoodfood food


0💬Normal

Don’t have the patience to be a perfectionist in baking too - not when food is involved 😂 Using up the ginger I didn’t need during early pregnancy - be a waste to throw it away of course! 😋 pregnant cravings growingbaby hungrymum nowillpower


0💬Normal

Today’s Flavored Coffee Experiment: A blend of 3 rich coffee bean varieties, a drizzle of vanilla paste, red pepper flakes, crushed pecans, fresh sage, xocolatlchocolate pure Cacao dark chocolate sweetened with epichoneycompany mangrove honey! OurAbodeFTW OurAbode fortworthfoodie fortworthfoodies fwfoodie fortworthfoodster fortworthfood ftworthfood foodie foodies tasty delicious foodstagram foodphotography foodporn cravings vegandelights vegan vegancooking tasteofvegan earthfriendly foodislife practicinggourmet gourmetwannabe love2cook loveofcooking loveoffood foodlove foodfoodfood food


0💬Normal

Today’s Flavored Coffee Experiment: A blend of 3 rich coffee bean varieties, a drizzle of vanilla paste, red pepper flakes, crushed pecans, fresh sage, xocolatlchocolate pure Cacao dark chocolate sweetened with epichoneycompany mangrove honey! OurAbodeFTW OurAbode fortworthfoodie fortworthfoodies fwfoodie fortworthfoodster fortworthfood ftworthfood foodie foodies tasty delicious foodstagram foodphotography foodporn cravings vegandelights vegan vegancooking tasteofvegan earthfriendly foodislife practicinggourmet gourmetwannabe love2cook loveofcooking loveoffood foodlove foodfoodfood food


0💬Normal

🥑we think avocado goes with just about any food! you can make it into a chocolate pudding or guacamole or add it to burgers and toast. possibilities are endless... . 🥑they are the perfect food for pregnant mamas and growing babies. thank you heart healthy fats, fiber <💩>, folate, vitamin c, potassium and many, many others! . 🥑how do you like to enjoy avocados?!


1💬Normal

Greek street food 🇬🇷 Chicken Rice Bowl grekostreetfood


1💬Normal

Thirty-five years young. Crohn’s Colitis since twenty-five. The biggest lesson I learned in the last ten years is to live today in today. Anxiety is worrying about the past and fear is worrying about the future. Keep it here. Keep it now. Celebrate today. 🎂🥰


1💬Normal

Look at this Scrumptious and loaded BUTTER CHICKEN PIZZA 🍕🤤🤤 . . 📍Cafe After Hours In frame ~ BUTTER CHICKEN PIZZA 🍕😋 Taste ~ 9.5/10 ❣ . . Tag your FOODIE FRIENDS 😋😍 LIKE..SHARE..COMMENT ❤ Follow eat.nd.repeat for more yummy updates ❤😋😍 eatndrepeat foodies foodblogging foodphotography foodporn delhibloggers foodlovers yummyinmytummy cravings like4like follow4follow foodreviews foodratings delhifood foodstagram indianfood pizza butterchickenpizza


0💬Normal

Currently missing my daily Californian bubble tea or “boba” as they call it- taro milk flavour is 🔥 but also had horchata ( Spanish drink of tigernut milk) that lit tasted like curiously cinnamon cereal milk 😍 🤫🤫🤫🤫🤫🤫🤫🤫🤫🤫🤫🤫 . Was acc contemplating getting a Deliveroo rn but the delivery is as much as the bubble tea 😔


1💬Normal

Señores, miren que delicia. Llegó la Sweet Angus con cebolla caramelizada. No dejes que te lo cuenten, ven y prueba esta deliciosa hamburguesa. burguer hamburguer hamburguesa delicious comida fastfood food deliciosa restaurant veron bavaro puntacana thursday mood cravings antojo traveling lomejor bueno riquisimo


0💬Normal

An ice cream a day, keeps the sadness away! 💜🧡 . . . let us know your favourite ice cream places + your fav ice cream flavours in the comments below! 🥳🍦 . . . . weekend vibes mood icecream dessert sweet sweetooth foodie food foodphotography love foodgram foodgasm foodporn quotes blogger karachiites karachi pakistan spreadlove baskinrobbins chocolate vanilla mousse chocolatecake cakes life cravings adventures adventure


3💬Normal

Disponible para hoy ésta delicia 😍 torta fría de chocolate 🍰 no te puedes quedar sin probarla 👌👌👌 Contamos con delivery GRATIS en zonas CÉNTRICAS 🚗✔✔ . . . Cake Chocolate Sweet Cravings Antojo Dulce Delivery Love Like InstaLove GoodVibes


0💬Normal

It's Rainbow on my plate! What: Rainbow Pastry Where: ricosindia truffling desserts dessertblog delhi pune sopunelbbpune


1💬Normal

With 6 sauces, 4 main ingredients, 9 toss-ins and 3 types of pasta to choose from, our Pasta Bar has WAY more 🍝 pastabilities 🍝 than we can count. . . . . manhattancafenc eatlocal buildyourown pastabowl penneforyourthoughts cravings instayum raleighnc dtr raleighfoodies pasta goodeats foodintheair 919eats buzzfeast pastabilities raleighfoodpics raleigh experiencerdu lunch instabowl dadjokes


0💬Normal

Celebrate mid-autumn festival with this special delicacy!! These moon cakes are delicious enough to take you on a gastronomical paradise . Radissonbluindore Chinese Desserts Sweewtooth Cravings Delicious Foodiesofindore Foody ForeverFoody Eat Repeat Potd


0💬Normal

WEIGHT LOSS FOR WOMEN vs MEN You may have noticed that women lose weight more slowly than men when it comes to weight loss. ⠀ Well, women have specific needs and these are largely ignored by the $60 billion weight loss industry that specializes in keeping the myth alive that in order to lose weight you need to eat less. ⠀ If it’s not calories, what drives weight loss? ⠀ Hormones: women have less testosterone. A hormone that boosts metabolism and keeps you lean. ⠀ Stress: women’s stress response system is more sensitive than men’s. Women also tend to juggle more with work, family and social commitments. Women also eat more when under emotional stress. ⠀ Food preferences: men are more prone to like meat, women love carbs. ⠀ Dieting: A staggering 80% of women are dissatisfied with their body and beat themselves up when attempting and failing to follow restrictive diets that do not take women’s unique biochemistry into consideration. ⠀ Keep this in mind: It’s not cravings that makes you fat. It’s the underlying hormonal chaos that leads to cravings weight gain. ⠀ Forget about the QUANTITY of food and focus on the QUALITY of it instead. ⠀ As a woman, you need a female-specific system that helps you deal with the underlying hormonal imbalance that has lead you to where you are today. ⠀ Want my help? Send DM me and let me know how long you’ve been on your weight loss journey for. ⠀ Xoxo Natalie


1💬Normal

Today i loved it 😋 Pav bhaji Comment down 👇👇 Follow food_web677 Follow food_web677 Follow food_web677 These noodles are my fav. 🔥 foodie foodgasm foodstagram foodblogger foodlover foodography foodies foodiepreneur sandwitch cheesesandwich zingyzest bellyovermind golgappagirl whitesaucepasta❤️ coldcoffee golgappa rasgulla cheesefries🍟 texasburger donuts🍩 cravings foodpassion_world instablogger foodblogger choco chocoworld aatanoodles


1💬Normal

_ I truly love this information! _ I do not crave sweets at all anymore, but if I want to have them, now I feel no guilt!🍦🧁🍰 _ Do I have to give up ice cream? Do I have to give up Starbucks? Do I have to give up candy? Do I have to give up pizza? Do I have to give up soda? Do I have to give up coffee? Do I have to give up nachos? Do I have to go on a diet? _ ✨The answer is nooooo✨ _ HOWEVERRRRRR.... _ Once you get your Glucose Levels a little more balanced, you will find that your cravings for unhealthy foods will CHANGE. It's just the way the body was created to work! _ There’s totally PROOF that regulating our blood sugar actually gives our brain self-control over sugar and carb cravings! _ 📉A study by scientists from Yale University revealed that "a drop in glucose levels leads to the brain losing self-control over food consumption! “ _ So maybe you’ll wanna take charge of your cravings by balancing your blood sugar a bit 👊🏽 (Btw, other side-effects include: natural energy, leveling your moods, and fat loss 🙋🏻‍♀️) _ ⚖️Balancing your body is the most important thing we can do... Once your glucose levels are more balanced, your cravings are put in CHECK!! And THEN your body sends a message to the brain telling it WHAT it really needs and WHEN! _ Don’t let cravings run your life anymore. Treat yourself because you can, not because you can’t stop. _ candida you change health guthealth sugar cravings


0💬Normal

I’m not ALWAYS AN ASSHOLE-dis what I do when my bff not feeling hot cuz “girlie” thangs and she’s craving sweets...at 8am. girlproblems101 cravings satisfythesoul pmsproblems seeuinhell🔥🔥🔥


0💬Normal

Burgers and beer is good anywhere, but the popular furger here comes with black buns.


1💬Normal

foodislife❤️ souptime cravings


0💬Normal

☕️ KETO COFFEE ON THE GO ☕️ . I was running behind this morning on the way to chaperone my kid’s zoo field trip. Thankfully, dutchbroscoffee had me covered! This is their Keto Cold Brew, Toasted. . Now onto the chaos that is being a chaperone!! . . . keto ketodiet ketoandcravings cravings healthylifestyle healthylife healthy healthyfood healthyrecipes healthyeating lifestyle journey ketosis lowcarb healthyfats gethealthy choices recipe protein wayofeating habits healthyhabits eattolive # coffee delicious yummy dutchbros yum


0💬Normal

Vegan Peanut Butter Cups ♥ Recipe for about 20 pieces: Melt 100g of vegan chocolate in a water bath. With a tsp put the chocolate in a cupcake muffin tray until the bottom is slightly covered. Put the muffin trays in the fridge until the chocolate is solid. After cooling down put 1 tsp in the middle of each cup on top of the chocolate and spread it out evenly. Now melt 200g of vegan chocolate and pour evenly over the peanut butter in the muffin trays. Put the muffin trays in your fridge so the peanut butter cups can become solid. Afterwards press them softly out of the cups. Enjoy 🥰 Recipe from the book “Vegane Süßigkeiten” written by Anna-Lena Klapp and published by vegan Neunzehn Verlag. vegan chocolate peanutbuttercups recipe baking delicious inspiration food dessert cravings veganfood cooking eat candy sweets vegantreats vegansweets peanutbutter


4💬Normal

Dream The sensation of being with your partner is the most wonderful thing, sometimes we love our partner in our dreams and thought that it would be great but we forgot the consequences about craving more love and that lead us to nowhere where we almost lost everything in life because of this situation and lose control on our life, love your partner is good in person and thinking about that it bad and even sometimes create a problem in relationship too. bobby love poetry lover couplegoals feelings passion lovers me tbh tht qotd dream dreaming dreamcatcher craving cravings thursdaymotivation thursdaynight thursdaythoughts thursdayquotes thursdayvibes thursdays thursday


2💬Normal

Cookies and coffee. 🍪☕️ wtf_gdl


2💬Normal

“𝗗𝗼𝗻’𝘁 𝗴𝗶𝘃𝗲 𝘂𝗽 𝘄𝗵𝗮𝘁 𝘆𝗼𝘂 𝘄𝗮𝗻𝘁 𝗺𝗼𝘀𝘁, 𝗳𝗼𝗿 𝘄𝗵𝗮𝘁 𝘆𝗼𝘂 𝘄𝗮𝗻𝘁 𝗻𝗼𝘄”⁣⁣ ⁣⁣ CRAVINGS! ⁣ Cravings can be a major roadblock for people when losing weight...⁣⁣⁣⁣ ⁣⁣⁣⁣ Everyone experiences cravings at some point when trying to lose weight - it’s completely normal⁣! ⁣⁣⁣ ⁣⁣⁣⁣ However, it’s how you deal with it that matters. Think of it like a fork in the road of your weight-loss journey...⁣⁣⁣ ⁣⁣⁣ ...you could give in to the cravings and go back to your old habits where nothing will change and you can stay as you are 🤷🏼‍♀️ ⁣⁣⁣ ⁣⁣⁣ 𝗢𝗥, you can 𝗰𝗵𝗼𝗼𝘀𝗲 not to give in, to 𝗰𝗼𝗺𝗺𝗶𝘁 yourself to the changes you are making to your health and to your life! 🙌⁣⁣⁣ ⁣⁣⁣ So, drink a glass of water 💦 do something to distract yourself, and you will soon find that the craving disappears and you’ll be on track and feeling super 𝗽𝗿𝗼𝘂𝗱!⁣ ☺️⁣⁣⁣ One2OneDiet ThisistheOne CambridgeWeightPlan CWP weightloss weightlossjourney changeyourlife losingweight losingfat onetoone vcld mealreplacement weightlosssupport cwpconsultant cwpdiet onetoonesupport⁣⁣⁣


0💬Normal

Should we add this to our cravings menu ? 😋*sausage *shrimp *corn *peppers *potatoes 🍤🥔🌽w/ garlic butter sauce cravingsbycammy food cravings baltimore owingsmills pikesville parkville dinners delivery pickup delicious homecooking soulfood dmv foodie cater personalchef


2💬Normal

Because I have a sweet-tooth and my cravings keep coming back & forth. So, an Enriched Smoothie Bowl for breakfast curbs my sweet-cravings for the entire day! Winner for me! 🙌 How do you take care of your Sweet-Cravings? Or you let the cravings go wild? sweettooth cravings breakfast thursday friends fitfam lifestyle caloriesincaloriesout


1💬Normal

पीलो बेटा Mocha है । 🤤 A must try Mocha Brownie (Thick Mocha mixed with crushed chocolate brownie) iceberg ,Model colony just at ₹40 😍 . . . foodblogger blog mocha cravings foodporn food foodgasm foodlover brownie sweettooth foodie foodphotography foodstagram


0💬Normal

منيحة وحدة Chicken Filet من عند المشهور بعد ال -gym إتصل هلق على رقم ال Emergency 01-833366 . . . almashhourfoodbeiruthungerfoodcomacravings


2💬Normal

I never eat fast food. But that doesn’t mean that I don’t have cravings. Eat your heart out McDonalds! Bacon, Egg & Cheese “Mock”biscuit: bacon friedegg cheddar cheese tatertots biscuit breakfast notfastfood cravings comfortfood eatlikeyoumeanit homechef cookingathome food foodie foodstagram instafood foodporn nom yum getinmybelly fatkidwantsout drool!


0💬Normal

Roasted Coffee Beans Full Of Antioxidants + Caffeine So इसको मिक्सी मे पीसो & Make Your Type Of Coffee 😅😌☕🔥 PS :- Too Much Caffeine Is Not Good For Health ⭐ . . . 📷oye_anurag . . . For More Insights⬇⬇⬇🍫❤ ••••••••••••••••••••••••• ••••••••••••••••••••••••• ••••••••••••••••••••••••• Follow ⬇⬇⬇⬇⬇⬇⬇⬇⬇💫 froozbaba froozbaba Follow ⬇⬇⬇⬇⬇⬇⬇⬇⬇💫 froozbaba froozbaba ••••••••••••••••••••••••• ••••••••••••••••••••••••• ••••••••••••••••••••••••• ⬇⬇⬇⬇⬇⬇⬇⬇⬇⬇⬇⬇⬇⬇⬇⬇⬇⭐ Follow, Mention & Like Froozbaba To Get Feature🔥 ⬆⬆⬆⬆⬆⬆⬆⬆⬆⬆⬆⬆⬆⬆⬆⬆⬆⭐ ••••••••••••••••••••••••• ••••••••••••••••••••••••• ••••••••••••••••••••••••• froozbaba Froozbaba cravings froozstagram foodgram yumm foodielife cheese coffee chocolate baked photography youtube likes forkyeah foodaholic foodphotography foodart feedfeed instafood foodaddict foodblogger foodporn drooling carpediem delhi India indianfood nomnom buzzfest


3💬Normal

Can’t sleep, thinking of you!! ensaimada cravings cafeysabel


1💬Normal

Now that vacations are far away we can only think about those sunny days and warm waters...😐 sardegna lamaddalena spiaggiailrelitto caprera blueshades mipiacci summer19 hotaf throwback calmafrancesco cravings italy


0💬Normal

It's Flat 50% off on optpfries if u order through Food Panda. Kahen jany ki zarurt nhi bethy bethy order kren😍 foodpanda_pakistan . . . . Ordered 2 Jalapeno Premium Chicken burger, pizza fries and masala fries. Everything was fresh and perfectly done. . . . . . Pizza fries 10/10 Burger 7/10 . . . . . . . . blog foodblog blogger lifestyle lahore lhr puranalahore androonlahore foodie eat cravings meetha travel explore johartown gulberg cake cupcakes customizedcake fondant buttercream tbtinternational instansbwa likeisresponsibility


16💬Normal

New blog post! Today’s post is a Meg’s Minute which are basically posts on whatever is on my mind lately💭In today’s Meg’s Minute I’m talking about the cravings I’ve been dealing with lately.🌮🥖🍕 I try to use mindfulness to notice my cravings. Typically I journal to get clear on what might be the deeper cause of my cravings. This last week I’ve been pretty worn out so instead of journaling I simply sat in silence before bed. I thought about what might be causing my cravings and realized I’m in the midst of a transition that is stirring up some emotions for me. I share on the blog how I got clear on the root of my cravings and how I use that info to deal with them constructively✨ linkinbio . . healthcoach cravings deconstructcravings iin t1dcoach mentalstrength mindfulliving mindfuleating megsminute t1dblog diabetesblogger diabetesblog


0💬Normal

Cooler temperatures = time for corn casserole! 🌽Cheesy, creamy and downright dreamy, this hearty dish will earn you plenty of Fetch Points (and it also serves 12!). ⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ .⁠ Partner FetchRewards SaveMoney EarnPoints MyFoodAndFamily Kraft Food Foodstagram Instafood eeeeats Yum Delicious FoodPhotography Recipe Cravings Coupon Rewards CouponCommunity FrugalLiving EasyMeals FallFlavors Casserole Corn Staub CastIron Party Bacon Cheese LoveMyPhilly OscarMayer


2💬Normal

Pizza or pasta, He asked, Misal pav, She replied... . The house of misal special- TANDOORI MISAL!!! If u want something special n spicy...u must go for tandoori misal.the_house_of_misal . DESCRIPTION :- Missal served in tandoor enhances it's taste and adds a good tandoor flavour to it. It is surprisingly blended well in flavours and definitely one of a kind. It is served in an earthen pot and it's smokey flavor can be felt in each and every bite making it taste heavenly. . . . PRIZE :- ₹ 85/- for two ppl. . . REVIEW :- Food :- 9.5/10. Service :- 7/10. Ambiance :- 4/10. . . . follow for more updates bhukkhad_aatma bhukkhad_aatmabhukkhad_aatma . .snapchat id :- shubbs_d . . 📍Near plaza cinema, kasaravadi , dadar, mumbai. . . foodfoodpornfoodfantasyfoodlovermisalpavmisalpavmumbaisfoodfoodinstainstainstagramfoodiefoodgasmfoodgramspicetastycravingsmaharashtraspecialdelightkhanepecharchajunkfoodjunkdadarthursdayseptembersoul


1💬Normal

Dal Makhni Rice with Green mint Chutney and onions what else do you want to have a satisfying dinner? . . 📍: Snack Junction, Nehru Place Market, Delhi . . . For more delicious food updates Follow fatgirl_appetite Follow fatgirl_appetite Follow fatgirl_appetite . Use fatgirl_appetite to get featured . . . delhifoodie delhistreetfood foodiesofinstagram delhifoodblogger indianfoodblogger indiafood foodindia foodbossindia soulfood souleater eatthis desifood cravings foodiesofinstagram radhekrishn23 #septzlikz19 foodpornshare foodphotononstop picoftheday eeeeats followforfollowback like4likes instayum instafood choclate yummy tasty foodpornshare imbhookad foodphotononstop


3💬Normal

Beef Noodles Therapy 🐮 . . . cravings satisfied aroi aroimak


0💬Normal

I'm a chocolatarian 👧🍫 I only eat Chocolate 🍫💝💯 chocolate love cravings


0💬Normal

Can’t get enough of peri-peri fries 🍟 The hera pheri fries are the most inexpensive, well made delicious fries in the city He has so many options in fries, this time I sticked to the basic tikha lal fries which were so spicy and tasty Price ₹60 100% recommended 😍 . . . . . . foodieludhianafriesdeliciousfoodstylistfoodlovebhukadbybirthbhukkhadfoodfoodyummysundaylunchcravingsfoodphotographyloveitindiaindianfoodiefoodeliciousperiperifriesgrillmastersburgerfriesfriesbeforeguysbrsnagarfoodiebhukkhadbuddies


1💬Normal

BOMBAY SANDWICH 🌱 I love this simple toasty filled with Indian seasoned mashed potatoes, onions, mint chutney and sweet tamarind chutney. 😌 . . . . foodstagram foodpics asianfood indianfood food asianfoodporn asianfoodies asianfoodie foodie foodporn foodphotography foodblogger yummy cravings hongkongfoodie hkfoodie hongkongfood hongkongfoodblogger hkfoodieblogger bombayfoodexplorer sandwich alootikki alootikkisandwich vegan vegetarian eeeeeats forkyeah


0💬Normal

Pan fried Noodles with Chicken Manchurian anyone ? . . 📍 : Tara Restaurant , Tibetan Colony , Majnu k Tilla . . . For more delicious food updates Follow fatgirl_appetite Follow fatgirl_appetite Follow fatgirl_appetite . Use fatgirl_appetite to get featured . . . delhifoodie delhistreetfood foodiesofinstagram delhifoodblogger indianfoodblogger indiafood foodindia foodbossindia soulfood souleater eatthis desifood cravings foodiesofinstagram aklzzz bactvgys foodpornshare foodphotononstop picoftheday eeeeats followforfollowback like4likes instayum instafood choclate yummy tasty foodpornshare imbhookad foodphotononstop


14💬Normal

homemade IDLI SAMBAR 🌱 Craving this South Indian dish big time! Idli is similar to Korean rice cakes because of their chewy texture however they are much more delicate and absorb much easier. Idli is made of semolina and yogurt then steamed. The idli has no particular taste so I love pouring Sambar (a South Indian curry) over so it absorbs all the flavors. When you bite all the curry rushes out and it super warm 🥰 . . . . foodstagram foodpics asianfood indianfood food asianfoodporn asianfoodies asianfoodie foodie foodporn foodphotography foodblogger yummy cravings hongkongfoodie hkfoodie hongkongfood hongkongfoodblogger hkfoodieblogger idli southindianfood feedfeedvegan feedfeed vegan vegetarian eeeeeats forkyeah


4💬Normal


Next Page

#dinner - #recipes - #food - #keto

counter