#gewicht

Ich hatte heute einen entspannten Tag und habe mir beim spazieren gehen die Gedanken völlig vergessen. Es hat mir gut getan, für mich zu sein. Gestern hingegen war es eine Katastrophe, aber das erzähle ich vielleicht ein anderes Mal. Jetzt mal ich mir einen gemütlichen Abend vor dem Fernseher, denn morgen steht einiges auf dem Programm. ootd outfitoftheday outfit outfittoday dailyme dailylook instadaily dailyinspo dailyinsta fashion curvygirl sizeinbetweenie gewicht weightlossjourney weightlossdiary weightloss abnehmen goldenemilch update gefühle chaos lachen fighter sonntag messybun


0💬Normal

Das war unsere Nachspeise. Würde ich aber auch nicht wieder kaufen. Das wird mit 250 ml Wasser angerührt und dann kommen 150g Joghurt (ich habe Skyr genommen) dazu. So schmeckt es halt auch.😣 . Vorhin gab es noch einen Götterquark aber ohne Obst heute für 206 Kalorien. Das Foto habe ich leider vergessen. . Jetzt geht es ab auf die Couch. Ich wünsche allen einen schönen Abend 🕯️ . yazio kalorienzhlen kaloriendefizit dit motivation ditmotivation kalorienzhlenmityazio abnehmen endlichschlank ranandenspeck essen ernhrung bewusstessen diet essenmitgenuss gesundessen essenmachtglücklich gesundeernhrung abnehmenohnezuhungern gewicht foodblogger abnehmenohnehunger gewichtreduzieren gewichtverlieren dittagebuch Intervallfasten


0💬Normal

Even wegen!! 🙃🐶🙂😁 * * * boomer boomerpup jongehond hondje wegen gewicht kenneldehoeve lief schatje boefje #🐾


1💬Normal

Nach einer Woche ohne kalorienzhlen , aber mit kontrolliertem essen musste Ich leider feststellen, dass ich kein gewicht verloren habe. positiv ist aber, dass ich bei allen Übungen mehr Gewicht nehmen konnte. - - - fit happy alter muskeln bodybuilding bodytransformation motivation masse massephase protein kraftsport krafttraining training abnehmen spaß sport gym run laufen joggen cardio


0💬Normal

***Neue Motivationssprüche verziehren nun die Trainingsfläche*** 😎💪 fitnessstudio fitness funktional gym oldschoolgym oldschool gewicht training trainieren pfullingen mmsgym87 motiviert motivation fit trainhard banner wand sprüche wanddeko 72793 #💪


0💬Normal

🏌️‍♂️👍🤙Seit langer Zeit mal wieder auf dem Golfplatz Golf Handicap Driver heimat lebensgefühl krafttraining Bodybuilding Cardio Workout laufen Training lifestyle joggen gewicht dit bavaria


0💬Normal

Zum Abendbrot gab es heute Chilli Con Carne und einem Brötchen mit 616 kcal. Heute lief es etwas aus dem Ruder, aber dafür bin ich vor dem Essen mit meinen Freund eine große Runde spazieren gegangen. Es war sehr schön bei diesem schönen Wetter. • besserleben abnehmen gewichtverlieren gesünderleben gewicht weightloss vorher vergleich runtermitdenkilos gesundleben kalorienzhlerin kalorienzhlen abnehmtagebuch essen essenstagebuch


5💬Normal

Einen entspannten Sonntag wünsche ich euch liebe Community 🤸🏻‍♂️ . Da ich vor kurzem noch nach meiner Meinung zum Thema stoffwechselkur gefragt wurde, werde ich das Thema heute mal in aller Kürze ansprechen 💥 Falls ihr hierzu ein ausführliches Video wollt, lasst es mich gerne wissen ❕ . Was ist eine Stoffwechselkur❔ . .➡️ Eine Stoffwechselkur ist eine über einen kurzen Zeitraum, z.B. 3 Wochen, stark kalorienreduzierte Diätform. Diese Diätform ist mit einer Einnahme hochdosierter Vitaminpräparate und Pflanzenstoffe sowie vielen Lebensmitteleinschränkungen verbunden. . Was ist das Ziel einer Stoffwechselkur❔ . .➡️ Eine Stoffwechselkur soll unseren Stoffwechsel ankurbeln, also dafür sorgen, dass Nährstoffe besser vom Körper aufgenommen werden. Dies soll über eine Entgiftung/Entschlackung unseres Körpers ermöglicht werden. . Was ist wirklich dran❔ . Wir nehmen stark ab, jedoch nicht über den vermeintlich angekurbelten Stoffwechsel, sondern aufgrund des massiven Kaloriendefizits. Hinzukommt, dass auch die zugeführte Proteinmenge meist so gering ist, dass wir vermehrt Muskulatur verlieren anstatt des erstrebten Körperfetts. . Wissenschaftliche Studien, welche positive Effekte einer Stoffwechselkur aufzeigen, gibt es bisher nicht. Im Gegenteil: Einige Untersuchungen kamen sogar zu dem Ergebnis, dass die Präparate zu Schädigungen unserer Leber führen können❕😯😯😯 . 💥 Fakt ist, dass der starke Gewichtsverlust auch ohne die zusätzliche Einnahme der Präparate eintritt. Wir können uns somit die 200 € oder meist noch mehr Euro sparen, welche so eine Kur meist kostet❕💥 . Habt ihr selbst oder eure Freunde, Familie schon Erfahrungen mit der Stoffwechselkur gemacht ❔ . . . . . . . . . . . . . . *Werbung, da Marke erkennbar, unbezahlt* detox entgiften entschlacken realitt abzocke dit bodylove abnehmen gewicht fit fitness gym gesundheit sport heretocreate bestecommunity münster community instafit fitfam trainer buildingastrongcommunity


2💬Normal

Personalisierte Plüschtiere nach deinem Wunsch 🧸🎈CHF 49.- plüsch baby babybambini name datum zeit gewicht grsse geschenk fall2019 babyboom welovebabies


0💬Normal

Puur Bij pure voor health past natuurlijk, een puur gezicht. Make up, ik hou ervan maar ik zie dat het ook veel nadelen heeft voor mijn huid ik draag nu al een week geen makeup omdat ik vakantie heb. En mijn huid is nu al verbeterd. Ok een pukkeltje hier en daar hihi. Ik zal dit vaker gaan doen, waarom zou ik niet net zo goed voor de buitenkant zorgen als ik voor mijn binnekant al doe. Hoe vaak ga jij puur natuur op pad? nomakeup eunaturale naturel nofilter pureforhealth puur fitnl fitdutchie makeupvrij natureleface iamwhoiam fitfam fitgirl fitfamnl fitdutchie instagram gewicht healthcoach  gezondleven  instagood selflove doelenstellen afvallen leefstijl healthcoach fitgirlsnl fitfam fitdutchies instafoodie


4💬Normal

Ups so im Stress und Verhungert gewesen, daß ich vergessen Foto zu machen habe. Vorspeise : Gurken-Carpaccio mit Tomaten und Feta Hauptspeise : Rollbraten mit Jägersoße, Blumenkohl mit Soße und Knödel Nachtisch : Vanillepudding Uns kann man Rollen 😉 Wünsche euch ein schönen Sonntag 😘 - 😎😎😎😎😎😎😎😎😎😎😎😎😎😎😎😎 - abnehmblog blog_de blogger fitwerden abnehmblog_de blog foodblog food dit bloggerin fit gewicht blogger_de abnehmweg2019 abnehmweg gewichtverlieren bloggerin_de abnehmen2019 abnehmen abnehmweg_de - 😎😎😎😎😎😎😎😎😎😎😎😎😎😎😎😎


0💬Normal

Mittagessen . Unbezahlte Werbung / selbst gekauft . Wagner Steinofen Pizzies Salami und ein Salat von Kaufland (Tomate /Mais). . Mausi wollte unbedingt Pizza und Pommes heute essen. Da ich aber gestern schon etwas über die Strenge geschlagen habe, gibt es für mich besser Salat dazu 😂 . yazio kalorienzhlen kaloriendefizit dit motivation ditmotivation kalorienzhlenmityazio abnehmen endlichschlank ranandenspeck essen ernhrung bewusstessen diet essenmitgenuss gesundessen essenmachtglücklich gesundeernhrung abnehmenohnezuhungern gewicht foodblogger abnehmenohnehunger gewichtreduzieren gewichtverlieren dittagebuch Intervallfasten mittagessen


0💬Normal

Da mein Freund und unser Kumpel unbedingt zum Burger King wollten musste ich auch etwas nehmen. Ich habe mich für Chilli Cheese Nuggets entschieden. Habe noch 2 abgegeben und hatte dann noch 4 Stück für 249 kcal. Hat jetzt eigentlich nicht so in mein Plan gepasst aber ok, ich mache das Beste draus. • besserleben abnehmen gewichtverlieren gesünderleben gewicht weightloss vorher vergleich runtermitdenkilos gesundleben kalorienzhlerin kalorienzhlen abnehmtagebuch essen essestagebuch


0💬Normal

Das sind die Maße von gestern früh, ein Tag nach der Anmeldung im Fitnessstudio. Irgendwie habe ich bei dem letzten Bild mit meinen Maßen manche Angaben um einen Zentimeter falsch übertragen, deshalb werden die Angaben, wie viel ich verloren habe, mit den letzten Maßen nicht ganz übereinstimmen, aber auch nur bei ein oder zwei Körperteilen und ca. einen Zentimeter. Dann kann ich ja jetzt sehen, wie viel ich durch den Sport verliere!🤩 . Bleibt gesund und munter!💪🏻🍏 . Werbung abnehmen Gewicht wiegen Waage diet Dit Ernhrung love weight spazieren Wald see hund Sport gym Fitness Figur gesund Gericht Essen lecker BMI glücklich Ziel bikini Zielgewicht McFit


0💬Normal

Cherries⠀ •⠀ •⠀ Het weer is mischien niet heel zomers meer maar met onze cherries krijg je het zomserse gevoel weer een beetje terug. ⠀ •⠀ •⠀ gezond gezondesnack lekkerengezond lekkereten eten snoepen sporten afvallen gewicht gezondheidsadvies gezondgewicht ouders ouderschap gezin gezin schoolplein school schoolreis snoeppot snoepjes bioscoop uitdeelzakjes indeklas suikervrij suikervrijsnoep gelatinevrij


4💬Normal

Es geht voran 🎉 mit ca einem Kilo pro Woche kann ich super leben. Ich fühl mich nicht eingeschränkt und muss noch keinen Sport dafür machen. Ich bin zufrieden 👍🏻 aus dem Intervallfasten bin ich aktuell auch raus. Ich konnte keinen Vorteil für mich feststellen 🤔 und Kalorienzählen muss ich so oder so 🤷🏻‍♀️ wobei ich auch das seit mittlerweile 5 oder 6 Wochen nicht mehr mache. Es läuft alles relativ intuitiv. if intermittentfasting intervallfasten fettlogiküberwinden foodbreak flü weightloss abnehmen gewicht Kalorienzhlen kalorienzhlenmityazio yazio yaziodeutschland werbung abnahme abnehmen2019 essen kochen


1💬Normal

wiegetag Man, was bin ich froh, dass ich trotz Fressattacken abgenommen habe. Da zahlt sich das tägliche Sportprogramm doch aus 💪🏼 Da fehlt auch nicht mehr viel, bis ich bei der Halbzeit angekommen bin - um genau zu sein, sind es noch 3,8 kg 🤩 Ich denke, bis Anfang Oktober sollte es zu schaffen sein 🤗 Und ab da an fehlt nicht mehr viel bis zum UHU 😋 Ich wünsche euch noch einen wunderschönen Sonntag 🌞 • • abnehmenabnehmen2019 gewichtverlierengewichtverlieren2019kalorienzhlenernhrungsumstellungjetzterstrecht meinneuesichweightlossgewichtranandenspeckwegmitdemspeckfitwerdenwiegenwaageweightlossjourneywochenendeaufgebenistkeineoptionfressattackebaldhalbzeit


8💬Normal

Woche 6 Minus Ein Kilogramm Seit Beginn Der Challenge Minus Vier Komma Neun Kilogramm Gesamtbilanz Minus Elf Komma Acht Kilogramm kaloriendefizit kalorienzhlen kalorienzhlenmityazio kalorien gesundleben gesundheit gesundessen essen lifehealthy healthylifestyle healthierlifestyle healthyfood health  abnahme abnehmen gewicht yazio kalorienzhlenmityazio gymondo yaziopro yaziocommunity familygoals lifegoals couplegoals motivation sommerfigur2020 bikinifigur2020


3💬Normal

Whoop whoop, endlich die 7 vorne 😃😍 zwar ist auch einiges an Wasser dabei, aber das Ergebnis gibt jetzt wieder einen extra Motivationsschub 🙃 abnehmen Wiegetag Abnahme fit Motivation weightloss Gewicht eswird gesund healthy Waage Wiegeergebnis


0💬Normal

Water, groene en zwarte thee en gefilterde koffie zijn de perfecte dorstlessers ✅. In zoete dranken zoals vruchtensap en frisdrank zitten veel suikers – en dus ook veel calorieën. - - Groene en zwarte thee, zoals earl grey, zijn gezond. Zwart wordt vaak gezien als ongezond. Dit is onterecht. 👎🏼 De groene en zwarte thee zijn afkomstig van de theeplant Camellia sinensis. De voorkeur gaat uit naar losse thee. Enkele gezondheidsvoordelen zijn: - ⚠️ Het bevat antioxidanten ⚠️ Het verlaagt de bloeddruk ⚠️ Verkleint het risico op hart- en vaatziekten ⚠️ Het beschermt je tanden tegen gebitsproblemen ⚠️ Het reinigt de huid - Door dagelijks drie koppen thee 🍃 te drinken heb je al gezondheidsvoordelen. Een theesoort die niet afkomstig is van bovenstaande theeplant bevat deze gezondheidsvoordelen niet. Kruidenthee is niet afkomstig van de theeplant. De bovenstaande gezondheidsvoordelen gelden bij kruidenthee niet. 😁 Drink gerust een kop rooibosthee, kamillethee, muntthee of gemberthee als je dat lekker vind. Het helpt om voldoende vocht binnen te krijgen en bevat geen calorieën. Sommige kruidenthee soorten bevatten plantengifstoffen. Door gevarieerd te drinken met andere dranken uit de Schijf van Vijf is de kans klein dat je gifstoffen binnenkrijgt. - TIP: 👉🏼 SWfit verkoopt naast haar voedingsschema’s en voedingsadviezen ook groene en zwarte earl grey thee. Leuk om cadeau te geven! Heerlijke, friszoete en gezonde losse thee. Klik op de link in mijn biografie om naar mijn cadeaupagina te gaan of ga naar www.swfit.nl/cadeau-artikelen. - Drink jij graag thee? 🍵 Wat is jouw favoriete soort/smaak? 💕


3💬Normal

Bei den Männern beträgt dieser Anteil 51%, bei den Frauen 33%. Der Unterschied zwischen den Geschlechtern ist weniger ausgeprägt, wenn nur die Adipositas betrachtet wird. . Folge uns für mehr 🇨🇭-Facts watson_swissfeed. swissfeed schweizerfakten gewicht übergewicht adipositas abnehmen fitness gesundheit waage


0💬Normal

🏋🏽‍♂️💪🏽 "Sie sag'n: Erfolg wird dich verbiegen Doch der Erfolg lässt mich nur fliegen Und das direkt zu Wolke 7 Bekommen das, was wir verdienen" Gzuz Wolke 7🎶 sportfitnessfitnessmovationgewichtmotivationlifecleverfit


0💬Normal

Willst du mehr Selbstliebe in deinem Leben haben, weißt aber nicht, wo du anfangen sollst?🤔⁠ .⁠ Genau darüber spreche ich in der heutigen Podcastfolge (Link in Bio) und ich teile mit euch 7 wertvolle Denkanstöße, wie ihr Selbstliebe in eurem Leben kultuvieren könnt (passt sowohl für Anfängerinnen als auch für Fortgeschrittene😉)⁠ .⁠ Hört unbedingt rein. Es ist wirklich eine sehr schöne Podcast-Folge geworden 😍 Und teilt gerne mit mir, was euch besonders berührt oder zum Nachdenken gebracht hat 🙏⁠ .⁠ Und markiert gerne Menschen, die diese Podcast-Folge bereichern kann🙏⁠ .⁠ MUCH LOVE, eure Viktoria 💗⁠ .⁠ selbstliebe selbstliebelernen selbstwertschtzung dubisteingeschenkfürdiesewelt teamliebe frauenpower bremen coaching onlinecoaching embodiment krperliebe hraufdinenkörper hraufdeinherz genießedeinleben seiduselbst dubistgenug dubistwertvoll dubistvollkommen gewicht krperbild stehzudir


0💬Normal

Ich habe mich doch dazu entschlossen paar Kleinigkeiten am 820 umzubauen✌🏼 _________________________ Partner: pics_by_kusen 615lsa_official johndeerepower nothingrunslikeadeere jphndeere6r johndeere 6195rpower 6195r 6r map anhnger fendt farmingsimulator19mods agroliner fendt vario 820 fendt820vario farmingsimulator19 fs19 gewicht grubber scheibeneggen ernte


0💬Normal

Eet jij weleens een poke bowl? Superlekker en supergezond! Ik eet dit graag als het warm weer is, soms bestel ik bij mano.bowls en soms maak ik hem zelf. Je kunt er allerlei groenten indien en vis of kip of beef. De rijst kan je weglaten of (deels) vervangen door sla of quinoa. Deze supermooie foto is van girlswhomagazine Infobestdiet.nl www.bestdiet.nl . . . . . girlswhomagazine mano.bowls manobowls pokebowl poke hawaii salade salad gezond healthy groenten verskoken dieetrecepten recepten vezels fibre veggie veggies vega vers verskoken vis fisch inspiratie foodporn gewicht dietist Leiden Leiderdorp Oegstgeest motivatie


1💬Normal

Wenn man Sonntag Morgen so geweckt wird, dann läuft es ganz gut😁😁😁😁 abnehmenGewichtSonntagKaffeeMotivationSonnegenießenabnehmenohnehungerIntervallfastenJetzterstrechtglücklichzufrieden


0💬Normal

Heute Morgen gibt es Frühstück mit allem drum und dran. Mein ganzes Frühstück hatte insgesammt 532 kcal. War sehr lecker mit Eiern und Brötchen. Ich wünsche euch einen schönen Sonntag. • besserleben abnehmen gewichtverlieren gesünderleben gewicht weightloss vorher vergleich runtermitdenkilos gesundleben kalorienzhlerin kalorienzhlen abnehmtagebuch essen essenstagebuch


0💬Normal

Einen schönen Sonntag ihr Lieben 🌺 . Ich starte mit einem Steinofenbrötchen, Belag und einem Ei. . Was macht ihr heute schönes? . Ich putze ein wenig und räume die Kleiderschränke von Sommer auf Herbst um. 😀 . Ich wünsche allen einen schönen Tag. . . yazio kalorienzhlen kaloriendefizit dit motivation ditmotivation kalorienzhlenmityazio abnehmen endlichschlank ranandenspeck essen ernhrung bewusstessen diet essenmitgenuss gesundessen essenmachtglücklich gesundeernhrung abnehmenohnezuhungern gewicht foodblogger abnehmenohnehunger gewichtreduzieren gewichtverlieren dittagebuch intervallfasten frühstück


0💬Normal

Het assortiment van de Aurile koffie en thee van FM is groot, maar welke varianten heb ik voor je? 🤷‍♀️ 💚☕ Metabolism. Ter ondersteuning bij het afvallen. Vetverbrandend en hongerstillend! DE AFSLANKKOFFIE op dit moment!!! ❤️☕ Energy. Bij een druk en onregelmatig leven kun je wel een energieboost gebruiken. GEEN ENERGIEDRANK MEER MAAR DEZE KOFFIE! 💙☕ Focus. Studeren, in de boeken, nadenken. Met deze koffie blijf je makkelijker gefocust. 💛☕ Irish cream. Gewoon omdat het lekker is. Denk aan Irish koffie, maar dan zonder alcohol. 😉 💚🍵 Green tea. Met schil van de citroen en zonnebloem-bloemblaadjes. Heerlijk genieten van een warme kop thee. SUPERGEZOND MET ANTI OXIDANTEN EN BIOFLAVONOIDEN, GOED VOOR JE IDEALE GEWICHT EN GEWELDIG VOOR DE HUID! koffie thee afvallenzonderdieet gewichtsverlies gewicht aurile fmworld green huid fmworldbenelux


0💬Normal

Guten Morgen! Was für ein 🌞 Tag . . Was macht ihr schönes? Ich werde mich nochmal im Sonnenstuhl räkeln und meine Erkältung auskurieren. Genießt den Tag! . . dit abnehmen fitness kalorienzhlen kaloriendefizit  fettabbau keinzucker abnehmblog gesundessen erfurt zuckerfrei wohlfühlgewicht wegmitdemspeck fitbit kampfdenkilos dittagebuch gewichtsmanagement  gewicht gewichtverlieren wunschgewicht fitfam ü40 ü50 fitü50 fitü40


0💬Normal

Lohnunternehmen Stotz mit einen Claas Axion mit Claas Cargos im Mais Transport unterwegs. claas axion cargos mais teamwork traktor hckseln # anhnger lohnunternehmen stotz landwirtschaft framing landtechnikfotos landtechnik technik agrartechnik agrar nature photography gewicht güstrow mcdonalds agriculture agriculture_global agriculturelife fendt


0💬Normal

gewichtsupdate . Zwar hab ich in den letzten Tagen ein Plus von 1kg zu verzeichnen, und das, obwohl ich nur gestern im Überschuss gegessen habe (*mimimimi* ich HASSE Wassereinlagerungen!!), aber im Durchschnitt sind des doch immerhin 700g weniger 😊 hätte trotzdem mehr sein können, aber der Körper wollte wohl nicht...😬 . Bin trotzdem schon gespannt, wann ich die 7 wieder begrüßen darf. . Dauert aber wohl noch ein bisschen, kommende Woche gibts viel zu essen...😅 für Montag Abend werd ich für den Stammtisch nachm Training Brownies machen, weil mein Freund am Dienstag Geburtstag hat, am Dienstag gehen wir zum Mexikaner und am Wochenende sind wir als Lager auf nem Mittelaltermarkt...😅 . Aber ich freu mich schon sehr drauf😍😊 . Muss ich halt schauen, dass ich mich an den übrigen Tagen ranhalte, drückt mir die Daumen!😅 vielleicht bin ich ja dann auch endlich wieder fit genug für Sport...die blöde Erkältung regt mich auf! Aber immerhin ist sie jetzt in den letzten Zügen und zum Schwertkampf geht's morgen auf jeden Fall wieder!⚔💪 . Euch noch nen schönen Sonntag!🤗💕 . . . abnehmen abnehmen2019 abnehmtagebuch abnehmreise food essen breakfast lunch dinner gewichtsverlust dit weightloss wiegen waage gewicht weightlossjourney weight kalorienzhlen calories kalorien keepgoing justdontquit dontquit nevergiveup dranbleiben aufgebenistkeineoption fettlogiküberwinden teamfettlogikfrei


0💬Normal

wollte euch ein kurzes update zum abnehmen geben. gestartet bin ich mit 115kg am 22.8. vergangenrn mittwoch zeigte die waage 110,6 kg an. atürlich istcerst mal einiges an wasser weg gegangen. aber meine klamotten sitzen etwas lockerer. die letzten 2 tage habe ich mich nicht so streng gehalten...bin aufs wiegen am mittwoch gespannt. abnehmenmitpco babypfunde insulinresistenz gewicht gesund abnehmen


5💬Normal

Meinen Sonntagmorgen hatte ich mir irgendwie angenehmer vorgestellt. Aber es kann ja jetzt nur besser werden. Kaffee hat zum Glück so gut wie keine Kalorien 😉Humor; gutelaune; Gewicht; gewichtreduzieren; Sonntag; beauty; Parfum; Parfüm; Waage; glam; style; Ü50; 50plusandfabulous; Produkttester; Kaffee; Kalorien


4💬Normal

⏰Sontag ! Zeit zu einem guten Frühstück : Müslibrot mit Frischkäse selbstgemachten Mirabellen und Pflaumen Kompot dazu eine Grapefruits. Und entspannen ! !!!! 😘 ----------------------------------------------------⏰Dimanche, le temps pour un super petit déjeuner : du pain aux müsli avec du fromage frais et une compote de mirabelle prune fait maison , une pamplemousse . Aller parti pour la détente ! !!! 😘 ---------------------------------------------------- gesundabnehmen gewicht regime regimeuse mangerbio mangersain bio simplecooking amazingfood yummy lecker herbst automne motivation homemade kochen frühstück petitdejeuner breakfirst morning gutelaune happy sontag dimanche sunday yummy wohlbefinden plaisir


9💬Normal

Guten Morgen zusammen, heute war Wiegetag nach 1 Monat. 2,5 kg weniger. Ich bin damit zufrieden. Noch 4,3kg bis zum ersten Etappenziel. Jetzt wird erstmal nen leckeres Frühstück gemacht 😍 abnehmen2019 fitfam fitnessaddict fitxmülheim fitx fitness abnehmen loosefat gutenmorgen waage gewicht sunday pictures pictureoftheday bodybuilding


3💬Normal

Meine Woche... Auf und ab. Aber momentan ab... Vielleicht klappt es diesmal mit der Annahme. Bin jetzt schon 15 Tage Fleischerei und es tut mir gut und stellt kein Problem in jeglicher Form dar. Die Familie zieht mit und das ist klasse... Also neues startgewicht für die neue Woche ist 103,8 kg. abnehmen weightloss fitbit 10000schritte abnehmtagebuch weightlossjourney fit wiegen tglicheswiegen wiegetag gewicht gewichtsverlust waage veggie


1💬Normal

Deinichmagmichgewicht


0💬Normal

Ich habe schon erste Änderungen an meinem Fitnessplan gemacht! Erst mal habe ich den Crosstrainer durch das Laufband ersetzt, da man einfach beim Laufband viel mehr Kalorien verbraucht, ist halt nur ein wenig anstrengender, aber auch wieder nicht mega anstrengend.😁 Außerdem hab ich zwei oder drei Übungen aus dem Plan herausgenommen und neue hinzugefügt. Vielleicht kommen demnächst ja noch ein oder zwei Aufgaben dazu. Jetzt bin ich echt viel zufriedener mit dem Plan. Es ist auch endlich was für die Arme dabei. Das Wichtigste ist für mich, dass ich meine ganze Haut straffen kann und nebenbei auch abnehme, dafür ist das Laufband gut. Hin und wieder werde ich auch mal beim Zumba teilnehmen, so einmal im ein oder zwei Wochen denke ich mal. Je nachdem. Die Kurse sind ja auch nicht jeden Tag.😁 . Bleibt gesund und munter!💪🏻🍏 . Werbung abnehmen Gewicht wiegen Waage diet Dit Ernhrung love weight spazieren Wald see hund Sport gym Fitness Figur gesund Gericht Essen lecker BMI glücklich Ziel bikini Zielgewicht McFit


0💬Normal

Mensch und Auto (7) Bestimmt fallen EUCH dazu auch noch Vergleiche ein ??!!!!! freu much drauf! gedankensprüchemenschautovergleich lustiglebenwortspielfehlervergessen imageprogrammierenwegfindenhell leuchtengewicht


2💬Normal

wie wahr🤣 Im Urlaub etwas zugenommen? das ist menschlich und võllig ok! Mit Lipoweg erreichen Sie erfahrungsgemäß eine Gewichtsreduktion von ca.6-8 KG in 4 Wochen... Haben Sie schon gehört,dass Lipoweg einen sehr schönen Nebeneffekt hat,nämlich Hautstraffung? erfahren Sie mehr bei einem kostenlosen Erstgespräch...wir freuen uns auf Sie! lipoweg lipowegberlin abnehmen abnehmeninberlin gewicht fett haut gewichtsreduktion schlank schlankwerdenschlankbleiben happy berlin homopathie heilpraktiker


2💬Normal

Heute bei My Chicken... Grillhähnchen, Chickenwings, Chickenfilet und Pommes. . Ich habe keine Ahnung wie viele Kalorien ich gegessen habe, es war jedenfalls wie immer extrem lecker 😍😍 . yazio kalorienzhlen kaloriendefizit dit motivation ditmotivation kalorienzhlenmityazio abnehmen endlichschlank ranandenspeck essen ernhrung bewusstessen diet essenmitgenuss gesundessen essenmachtglücklich gesundeernhrung abnehmenohnezuhungern gewicht foodblogger abnehmenohnehunger gewichtreduzieren gewichtverlieren dittagebuch Intervallfasten mittagessen fastfood


0💬Normal

Geburtstafel junge


1💬Normal

Geburtstafel


1💬Normal

Besuch in der alten Heimat. 🤗 Immer wieder schön in die Natur abzutauchen. Bad Marienberg Viadukt Westerwald Natur spaziergang Achtsamkeit heimat Urlaub wandern Genuss gefühle wohlfühlgewicht Westerwaldsteig ausflug ausflugsziel gewicht gewichtsabnahme belohnung sinnlichkeit


0💬Normal

--- Zwei Mal 80kg 2019/2018 Körperfettanteil und Muskelanteil kann man nicht auf der Waage sehen. Deshalb hat das Gewicht bei einem Sportler kaum Aussagekraft. Wichtiger ist der Spiegel, ein Maßband und/oder Beurteilung von Profis. Wann geht man in die Definition und wann in den Aufbau? Das wird nicht nach Gewicht sondern Körperfettanteil entschieden. --- bodybuilding fitness sport sportismylife gewicht Krperfettanteil definition defiphase massephase


4💬Normal

Letzte Woche..Familienausflug ..😜 workoutimmer&überallzu jeder Zeitwenn das eigene Körpergewicht nicht mehr ausreichtGewicht vom Neffen on topzackich hab 20 Kg mehrer den besten Blick


0💬Normal

🍫 Schoko-Proteinwaffeln 🍫 . So meine Freunde, damit ihr euren Sonntagmorgen mit einem leckeren Frühstück starten könnt, gibt es heute das Rezept samt Anleitung für diese genialen Schoko-Proteinwaffeln 😍😍😍 . Zutaten (Ca. 12 Waffeln) 🗒 .👉🏻 250 ML. Milch 1,5 % Fett .👉🏻 180 Gr. Dinkelmehl .👉🏻 50 Gr. Erythrit .👉🏻 40 Gr. Schokoprotein .👉🏻 20 Gr. Backkakao .👉🏻 2 Eier .👉🏻 1 TL Backpulver .👉🏻 1 Prise Salz . Zubereitung 📜 .1️⃣ Eier trennen und alle Zutaten, bis auf das Eiklar, in einer Schüssel mit einem Schneebesen gut vermischen❕ .2️⃣ Das Eiklar mit einem Rührstab zu Eischnee mixen und anschließend vorsichtig unter den Teig mischen❕ .3️⃣ Einen kleinen Klecks Teig in das Waffeleisen geben und für 1-2 Minuten backen lassen❕ . Nährwerte (pro Waffel) 📊 .🔹️92 Kalorien .🔹️6 Gr. Protein .🔹️16 Gr. Kohlenhydrate .🔹️2 Gr. Fett . 💥 Falls die Waffeln sich nicht aus eurem Waffeleisen lösen wollen, empfehle ich euch ein Ölspray zu verwenden, das wirkt wahre Wunder 💥 . Viel Spaß beim Nachmachen meine Freunde 💥 Lasst mich wissen wie es euch geschmeckt hat und verlinkt meinen Account auf euren Kreationen ❤ . . . . . . . . . protein schoko waffeln frühstück süßerezepte rezepte bodylove abnehmen gewicht fit fitness gym gesundheit sport heretocreate bestecommunity münster community instafit fitfam trainer buildingastrongcommunity


0💬Normal

Mittagessen Heute gab es Spinat mit Kartoffeln und Rührei 🤤 Meine Portion hatte nur 220 kcal, daher gab es noch ein Proteinshake hinterher und kam so auf 415 kcal. Habt noch einen schönen Samstag und bis morgen 💕 • • abnehmenabnehmen2019 gewichtverlierengewichtverlieren2019kalorienzhlenernhrungsumstellungjetzterstrecht meinneuesichweightlossgewichtranandenspeckwegmitdemspeckfitwerdenwiegenwaageweightlossjourneywochenendeaufgebenistkeineoptionspinatrühreikartoffelproteinproteinshake


6💬Normal

Bei uns war heute Pferdegewicht - Oliver Kirschenhofer mit der Pferdewaage ⚖🐴 da. ☺️🎉 Balthasar ist wie immer problemlos beim ersten Anlauf auf die Waage gestanden👍🏼 Ratet doch mal, wie viel er gerade wiegt, ich sag mal so viel: Ich bin damit absolut zufrieden☺️ (Die Trense auf dem Bild ist nur weil es so eleganter aussieht und wir die Bilder im Rahmen eines Shootings gemacht haben...🙈 Ansonsten kann Balthasar auch quasi ohne alles auf die Waage stehen😅👍🏼) ⭐️ balthasarvomalpenhof balthisblog pferdewaage pferdegewicht pferd horse pony caballo cheval islandpferd islnder icelandichorse waage gewicht mobilepferdewaage fotoshooting shooting beauty proud equestrian horsegirl horseriding reitsport


3💬Normal

Zucchini-Kartoffel-Auflauf mit Knoblauch Rezept gefunden auf chefkoch - 😎😎😎😎😎😎😎😎😎😎😎😎😎😎😎😎 - abnehmblog blog_de blogger fitwerden abnehmblog_de blog foodblog food bloggerin fit gewicht blogger_de mittagessen abnehmweg2019 abnehmweg gewichtverlieren bloggerin_de abnehmen abnehmen2019 abnehmweg_de rezept rezepte vegetarisch beilagen snack - 😎😎😎😎😎😎😎😎😎😎😎😎😎😎😎😎


0💬Normal

Aus Book von 🤓🤓 meinefamilieundich_magazin 2007/9, gibt heute unseren Mittagessen : Tomaten mit Leber - 😎😎😎😎😎😎😎😎😎😎😎😎😎😎😎😎 - abnehmblog blog_de blogger fitwerden abnehmblog_de blog foodblog food bloggerin fit gewicht blogger_de mittagessen abnehmweg2019 abnehmweg gewichtverlieren bloggerin_de abnehmen abnehmen2019 dit magazin abnehmweg_de books rezept rezepte quark vegetarisch meinefamilieundich_magazin - 😎😎😎😎😎😎😎😎😎😎😎😎😎😎😎😎


0💬Normal

Heute genau vor 5 Monaten habe ich gestartet mit kalorienzhlen , seit ein paar Wochen mache ich krafttraining und ausdauertraining im Wechsel. Ich habe heute ein Minus von 29 kg 🍀. Einiges muss natürlich noch runter 😬. Ich fühle mich so fit wie schon lange nicht mehr und Bilder von mir helfen mir dabei zu visualisieren, wieviel Gewicht ich verloren habe (denn so im Alltag sehe ich das leider nicht so wirklich 🤷). Ich wünsche Euch einen fantastischen Samstag 💙💚💛🧡💜♥️ ________________________________________________ gewichtsverlust gewicht weightloss minus29kg 29kg gesundernhren gesünderleben healthy healthyfood lifestyle healthyliving stillcurvy kalorienzhlen bodytransformation estutsichwas weitergehts yazio kalorienzhlenmityazio


36💬Normal

Einen schönen Samstag ihr Lieben. . Nach einem leckeren (etwas zu viel) Frühstück sind wir an den See gefahren. Die Kinder spielen und wir genießen die Sonne. 🌼 . Ich wünsche allen einen schönen Samstag. . yazio kalorienzhlen kaloriendefizit dit motivation ditmotivation kalorienzhlenmityazio abnehmen endlichschlank ranandenspeck essen ernhrung bewusstessen diet essenmitgenuss gesundessen essenmachtglücklich gesundeernhrung abnehmenohnezuhungern gewicht foodblogger abnehmenohnehunger gewichtreduzieren gewichtverlieren dittagebuch Intervallfasten frühstück


0💬Normal


Next Page

#dinner - #recipes - #food - #keto

counter