#inthekitchen

✨Deck the Halls with lots of Prosecco✨ .. I didn’t think I would be this excited for my first drink after 10 months 😂 but the lack of sleep is catching up to me and when I learned that having a small glass while feeding baby is scientifically safe ...🥂🍾 .. There has and always will be controversial thoughts on this subject (as I believe everyone is entitled to their own opinion) 🍼but according to Dr Jack Newman (I encourage you to look him up!) 👨🏼‍⚕️ “Reasonable alcohol intake should not be discouraged at all. As is the case with most drugs, very little alcohol comes out in the milk. The mother can take some alcohol and continue breastfeeding as she normally does. Prohibiting alcohol is another way we make life unnecessarily restrictive for nursing mothers.” .. I’ve never been a big drinker (can’t do more than 1/2 glass 🙄) but I’m not going to lie .. it’s helping me to relax a lot sooner and a lot more 🙏🏻 .. What are your thoughts 💭? .. . . . . . . . . . . . . . love healthymom wellnessnutrition wellnessmama wellnessinfluencer healthinfluencer healthentrepreneur modernmama nutritiontips healthybalance torontonutritionist prosecco🍾 breastfeedingmom inthekitchen nutritionistswhodrink momswhocook momfashion


0💬Normal

Winter is coming. Warm up with a bowl of chefjj's Bebop Chicken Chili. Try his recipe at Citymeals.org/onthemenu. . . . . . . . . citymeals mealsonwheels nyc nyceats nycseniors nourish fighthunger endelderhunger community restaurantcommunity newyork yum foodstagram foodie instafood chef cheflife eater eaternyc yummy chili winter warmup chickenchili newrecipe recipe onthemenu inthekitchen


0💬Normal

Next kids class is a perfect treat for Xmas: 👇 Panettone filled with artisanal ice cream and decorated with sugar icing. Super! ❤ SATURDAY 14th DECEMBER, h16:30 Gelateria Il Pineta - Monte San Giusto Info & bookings 📩 pls D.M. me . . . inthekitchen bimbiincucina bimbiincucinaconlochef cakedecorating icecream semifreddo fun4kids partytheme minichef


0💬Normal

It’s back ! . It’s the week before Thanksgiving, so here’s a recipe using Brussel sprouts to make a side dish to take to your gathering 🦃 . . So many people are hesitant to cook with these, but mostly due to not knowing how to cook them or how to use them in a recipe. . . Today I am sharing one of my personal favorites, and a dish that my own family asks for each holiday when we get together. 🦃 . . .👉🏼link is in my profile! . . . ontheblog recipes thanksgivingfood eatsmart holisticnutritionist veggies foodtips blogger inthekitchen whattocook healthyliving friendsandfamily healthybodies healthspo cleaneating holidayfood familyfood thinkoutsidethebox nutrition newrecipes foodinspo inspiration fitandhealthy beblessed thankful sidedishes easyprepmeals healthyeating foodie brusselsprouts


0💬Normal

I get to work my “dream job” at home (or on the go), on my time schedule, with friends, using & sharing a multitude of tried and true everyday products we love ✨ *bonus* all the FREE rewards each month, a steady paycheck that keeps growing- all thanks to a company that has paved the way over 25 years in unmatched quality & commitment when it comes to sourcing, science, and standards. When I see the hundreds/thousands of testimonies (including my own) of how these oils and products have greatly impacted better health and wellness, and I get to be a part of that... well my heart is just continually overjoyed❣️ Do you love your job? Would you like to? I have a community of growing boss babes, dedicated, willing, thriving, and I want you to join us! The opportunity is always available, I’m here to walk alongside of you, and what fun we would have!! like my girl here dwellandwell and I putting together little samples & appreciation gifts for our YL members, just because. Our work days lately have consisted of a once/week meet up to discuss biz moves, sample products, go through Q&A’s, laugh so hard, and of course eat so well.... basically an encouraging way to keep each other on track. “We rise by lifting others” 💞 . . . . inthekitchen gather workflow workdays loveyourjob communitylove oilers bossbabesunite familyandfriends quickquiche quiches yleo premiumstarterkit jobopportunities workfromhomelife wahmlife essentialoilswork healthandwellbeing oilymama instablogging planttherapy heartofthehome prayeatlove businesswomenlinkup appreciationgifts risebyliftingothers sahmomlife seedtoseal selfcareaccount


0💬Normal

استمر فى دعائك فربما تُساق لك البُشرى قريباً ويجعل الله فيما تتمنى يسراً وتسهيلا 🕊💜 #جمعه_مباركه chef_yasmine_tayea foodporn foodie foodstagram foodgasm foodphotography foodblogger foodpics foodlover foodpic foodies foods foodblog foodgram foodlovers fooddiary foodstyling foodart foodlove foodphoto foodiegram Chef InstaChef Cook Cooking Baking Recipe ChefsOfInstagram InTheKitchen


1💬Normal

💜 Best Seller 🎁 Great Gift 🎉 Sale Priced 5️⃣ Easy Pays Snack, store and so much more with this S/3 24 oz. Glass Storage Bowls w/Gift Boxes! Perfect way to gift sweets & treats to those on your list 😊🎄🛍Item K49435 available through the "Shop on QVC" link in bio! . . . taratemptationsholidaygiftsgiftguidechristmasgiftideasgreatgiftgiftideasforhergiftsideasperfectgiftsgiftgivingmadeeasygiftguide2019greatgiftideasgiftsforthecookchefgiftsgiftsforthebakergreatgifts2019bakebakingtruecookschefsofinstagramcheflifekitchencentertainingintheKitchen


1💬Normal

Raise your hand 🙋🏼‍♀️if you've got a TON of family coming over for Holiday celebrations in the coming months! 🎄 Does anyone else like to have all their food prepped in advance of guests arriving? I don't know about you, but even though I'm a seasoned cook I get distracted very easily and can't be trusted to keep things on schedule once our company starts rolling in!⁠ ⁠⠀ Something that helps a lot is this super fun Cooking and Baking Basics Cheat Sheet! 🙌🏼 Print this off and keep it in your kitchen for easy access - we've got you covered with all the cooking times, measurement conversions, salad dressing ratios and more! Comment below if you have this cheat sheet and love it! Anyone else have some good tips for prepping food ahead of time before your company arrives? Let us know in the comments!⁠⠀ .⁠⠀ .⁠⠀ .⁠⠀ .⁠⠀ .⁠⠀ ⭐️ ⭐️ ⭐️ ⭐️ ⭐️ ⁠⠀⁠⠀ linkinbio to shop now!⁠☝🏼⁠⠀ .⁠⠀⁠⠀ .⁠⠀⁠⠀ .⁠⠀⁠⠀ .⁠⠀⁠⠀ healthymealprep mealprep cookingbasics healthyrecipes healthyeats healthnut cheatsheet healthyfood healthy eatclean cleaneating nutrition mealplan healthyeating foodie healthyliving wholefoods learntocook cookingclass lovetocook neverstoplearning inthekitchen


0💬Normal

Et nous, on a cuisiné Derek de belleroseofficial dans sa cuisine 🦞🦞🦞 linkinbio inthekitchen bellerose rectoversoafaim rectoversoisback derekvh


2💬Normal

Personal sized {Blueberry Pie} in my reusable culinayogurt terra cotta cups! I love that they’re oven safe.....and I’m glad that I stocked up on them before the new glass jars were used. ☺️☺️ notanad ilovethisstuff


2💬Normal

Counting down to Christmas like...... unbothered 🎄


7💬Normal

I don’t bake cakes that often. It’s mostly for our family gatherings. My family has a tradition of getting together every last Friday of the month and every family brings in one dish to the venue. . . So I’ve been having copious amounts of cream cheese frosting in my chiller and wanted to use it up. So I weighed it, added a few eggs, a bit of flour and my vanilla extract and whisked it really well. Then poured the batter into cupcake liners and baked them. 👩🏻‍🍳 . . It was only a trial . Had set my mind for it to fail. 🙄 . . But then it actually set and I refrigerated it. And topped some with caramel sauce and pecan, and some with chocolate ganache and raspberry. 😍 . . . And the verdict was that This cheesecake turned out even better than my regularly baked mini cheesecakes. 🤩 . Now, I don’t know the exact measurements of anything to make it again. 🤭 . . . . . trialanderror cheesecake cheesecaketime cheesecakelovers cheesecakes cheesecakelove cheesecakecupcakes dessertstagram caramelpecan raspberrychocolate thekitchn eeeeeats dessertporn yummyinmytummy inthekitchen abudhabifoodies uaefoodbloggers bakersofinstagram uaefoodies bbcgoodfoodmiddleeast uaebloggers uaeinstagram youae abudhabiblogger abudhabifood myabudhabilife


2💬Normal

MAP Youth did such an amazing job putting together this year's Give Thanks potluck! We loved the mix of traditional Thanksgiving dishes and multicultural favorites, from stuffing to samosas, pecan pie to Puerto Rican rice. We are so so grateful for the diversity within our community! ❤️ FALLintoGRATITUDE thanksgiving givethanks MAPYouth


1💬Normal

Join us for this light-yet-satisfying dish of King Salmon, Chard, and Sundried Tomato Pesto Orzo 😍 Just add a glass of wine and you have a match made in Stampede66 heaven! . . . stampede66 visitallen allenfoodie alleneats deltahotels deltadallasallen southinyourmouth southernkitchen southernchef delicious foodstagram inthekitchen onthetable Seafoodlovers salmon noms fresh eeeeats foodporn goodeats devourpower foodgawker


0💬Normal

Takie tam czwartkowe wieczorne atrakcje 😜🙃🧁 W końcu tytuł przedszkolaka tygodnia zobowiązuje 😉 Chyba należy mi się tytuł matki miesiąca, a przynajmniej tygodnia, bo musicie wiedzieć, że w kuchni ograniczam się do niezbędnego minimum (choć wielu twierdzi, że z całkiem dobrym skutkiem 😜) Tak więc upieczenie trzech partii babeczek to był całkiem niezły wyczyn w moim wykonaniu 🤷‍♀️🙃😉 Dobrej nocy dobrzy ludzie 🌙 . . . babeczki czekolada foodporn food foodie foodphotography cooking cookies muffinki muffins kitchenlife inthekitchen kitchendecor mykitchen thursday eveningvibes eveningmood myhome foodstagram muffintime kitchenset kitchenlove kuchnia wieczorem dladzieci


2💬Normal

Seit März 2016 zeige ich Dir hier auf Instagram meine Kreationen. Ich habe Kuchen, Torten, Cupcake gebacken, dekoriert und viele verschiedene Designs gezeigt. Meine Favoriten waren aber schon immer Cookies. Ich liebe sie einfach über alles,... von einfach bis klassisch. ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ Heute möchte ich die Gelegenheit nutzen und mich bei Dir bedanken, dafür dass Du mich auf meiner Reise unterstützt. ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ Es war/ist eine wilde Fahrt und ich kann es kaum erwarten, was als nächstes kommt. ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ Von ganzem Herzen lieben Dank! 💖 ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ Jeder Mensch braucht Motivation, um handeln zu können. -unbekannt⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀cake kekse pltzchen konditor lecker backen backenistliebe backenmachtglücklich backing cookietime gebck backenentspannt cookies cookielove backery krümel max ausmeinerküche heresmyfood aufmeinemteller backenentspannt ichliebefoodblogs inthekitchen


4💬Normal

LYCHEE, baby. The one food my kids won’t eat 🤣 ⠀⠀⠀⠀⠀⠀⠀⠀⠀ If served fresh (not canned) and finely chopped or thinly sliced, lychee fruit may be introduced when your baby is 9 months old and has some ability to chew and process food. (Lychee is a firm fruit and while teeth are not necessary to safely eat them, the ability to make chewing/munching motions will help.) ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Nutritionally, lychees boast a lot of vitamin C (more than 🍊!) as well as antioxidants. They also contain trace amounts of B-vitamins including folate, blood-healthy minerals (iron, copper, magnesium, manganese), a decent amount of omega-3 fatty acids.🙌🏻 ⠀⠀⠀⠀⠀⠀⠀⠀⠀ To serve lychee, buy fresh, ripe lychees and remove the outer skin and inner seed, which is slightly poisonous (and a choking hazard). Note that canned lychees are often preserved in thick, sugary syrup, which is not appropriate for babies or children under the age of 2 (and even then, not ideal). ⠀⠀⠀⠀⠀⠀⠀⠀⠀ 🚨The firm, slippery flesh of lychee fruit can present a choking hazard.🚨 ⠀⠀⠀⠀⠀⠀⠀⠀⠀ For babies younger than 15 months old, it is best to thinly slice or finely chop the fruit once the outer peel and inner seed have been removed (you may find it easiest to serve atop yogurt). ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Lychee Fruit Salad o 4 fresh lychees o Blueberries (quartered) o Pineapple (chopped) o Dried coconut (unsweetened) ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Peel, pit, and finely chop the lychees. Mix all of the cut fruit together in a bowl, adding a spoonful of dried coconut. Serve in a bowl that suctions to the table for hand scooping and/or pincer grasp. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⭐️Tip: Lychees are high in natural fruit sugar (as are apples, bananas, mangos, pears) but that blood sugar spike to-be can be balanced out with foods high in protein and fat, such as coconut. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ 💥💥💥 ⠀⠀⠀⠀⠀⠀⠀⠀⠀ FingerFoodFirst SolidStarts babyledweaning babyledfeeding babyled firstfood firstfoods startingsolids babysfirstfood First100Foods babyfoodinspo blw lychee babyfoodideas makeitdelicious inthekitchen tastingtable feedfeed whatifeedmybaby blwinspiration blwfood intuitiveeating babyledrecipes blwrecipes blwinspiration blwtip blwmenu eatyourveggies andyourlychee


0💬Normal

What better way to spend the day off than making cannabis cannacoconutoil . . . . . cannabiscommunity 420 getbaked thingstodo getlit inthekitchen weedstagram420 staylifted


0💬Normal

Just in time for Thanksgiving! I wanted to share this pie crust by Wholly Wholesome I’ve been using if you are celiac like myself. Sometimes these GF/DF recipes for pie crust get so out of hand or fall apart after all the work. I found this in the freezer section. It’s GF, DF, egg free, peanut free, & fish free! Comes in a two pack and tastes delicious!! Happy Thursday Friends! 🦃 . . glutenfree glutenfreerecipes dairyfree dairyfreerecipes peanutfree allergyfriendly glutenfreeeats celiacdisease celiac pumpkinseason pumpkinpie itsfall inthekitchen eats letterboardquotes thanksgiving the_montanagirl


3💬Normal

One of my favorite places to be is in the kitchen with this guy 😍 Tried our hand at homemade pasta this past weekend (SO good) along with pheasant pot pie and topped it off with apple crisp 👌🏼 . . InTheKitchen MarriedLife LivingTheDream


2💬Normal

Don't know what to cook for dinner? How about some nice Pepper Steak?! 😋😋😋 foodlovers foodvideos foodporn islandlife islandfood jamaicancuisine jamaicanfood jamaicandinner jamaicandishes jamaica jamaicandish peppersteak chef cooking inthekitchen


0💬Normal

Frolla con ganache al cioccolato bianco, gelée all’arancia e gocce di cioccolato fondente recipe mealidea delicious myplate kitchenlife inthekitchen homemade dishes cucina chef piattoricco ricettadelgiorno ricetta food torta tortadiarance osteriazelata


0💬Normal

☕️☕️ Je suis dans quel mood selon vous? 1- « Nespresso... what else? » (voix de george Clooney 2- « uuuuuun jouuuuurrrr mon priiiiiince viendraaaaa, deeeessss cooookiiiies iiiiil mangeraaaaaaa🍪 » (heuu ouai je crois que c’etais ca les paroles non🤔) . Commentez juste en dessous👇🏾🤪 . . . . 📸 cyclopix971 👩🏾 cookie_g79 . . . . openminded_team openminded_team photography photooftheday photo photographer nespresso nespressomoments whatelse mood moodoftheday modelephoto modele passion passionlingerie sexy boudoir inthekitchen pink rose cafe cup therapie cookie


7💬Normal

RESTOCK: 6 copper ladles and 6 serving spoons now available in the shop!


2💬Normal

Necessity is the mother of all inventions, and this is dedinitely my favourite one.😉😋 Since there is scarcity of potable water in rajasthan, there are lot of recipes that have milk, curds and butter milk as the base ingredients of curry. One of the main lip smacking dishes of buffet menu of rajasthan is "gatte ki sabzi". And this gatte ki sabzi is not only about necessity because of lack of fresh greens in sand dunes of rajasthan but it also signifies the royalty of rajasthani maharajas. See!!! Its beauty can give tough fight to even fresh greens😍 lost_recipes chef instachef cook cooking recipe cheflife chefsofinstagram perfectlyplated gourmet gourmetart makeityourself inthekitchen cookniche foodstyling recipeoftheday truecooks food foodporn yummy foodie delicious breakfast yum lunch cookingfortheinsta eating delhieats nomnom feedforsoul


0💬Normal

What fun we had in the snazzy brand-spankin' new commercial kitchen at the Valley of the Sun JCC!! thejscottsdale vosjcc . . . ✔️ Multi-generational ✔️ Multi-cultural ✔️ Multi-tastful . . . I truly enjoy bringing about a sense of community with an emphasis on the human connection! Among a group of 10 individuals who did not know each other before the cooking event, we realized that 1/2 of us lived in Chicago at some point in our lives, and 1/2 of us were born in Michigan... all meeting in a kitchen over 1,700 miles away. What a small world! . . . These cooking experiences focus on healthy plant-based meals, but they never fail to go way beyond my expectations of creating beautiful connections! . . . Looking to incorporate more plant-based foods into your repertoire?  DM me or email gitawarriorinthekitchen.com to talk about your personalized vegan/vegetarian meal planning strategy based on your lifestyle, nutrition plan, food allergies and/or intolerances. . . . I'd also love to plan your next team building/corporate event and/or celebration, where you can bond in the kitchen and at the table! . . . FOLLOW on IG 👉 Warrior In The Kitchen⠀ .⠀ .⠀ The possibilities are endless!⠀ ⠀ cookingclass cookingtips lovemom nutrition plantbased cleaneating healthyfamilies personalized culinaryexperience vegetarian glutenfree nutritious healthyrecipe spicy spices homecooked homecooking gathering friendship meetnewpeople socialevents healthycooking cookinglessons vegetarian vegetables vegetarianrecipes inthekitchen atthetable soulfood warriorinthekitchen


2💬Normal

I made a meal with the lovely ginaism and happy to announce she survived my cooking and is alive and well today. I made garlic and soy sauce salmon, roasted Mexican zucchini with sweet corn and a basil, parsley, garlic, Thai pepper and cheddar sauce. Along side seasoned grilled endive. Wasn’t too shabby 👌🏽seafood salmon testkitchen food foodporn inthekitchen foodie dinner healthyeats healthyeating vegetarian pescatarian grill garlic cheese


1💬Normal

Alright Mamas - where are you at? Thanksgiving is around the corner - I can feel the pressure start to kick in! 🤦‍♀️ I’ll be honest though; I love it seeing my family, cooking, and all to be had on this day. I have learned over the last few years to not be so darn uptight and critical on myself! What is something you do to keep yourself calm? Is it wine? A nap? Eat more food? Share your best tips below 👇👇 p.s. you are amazing, loving, strong, happy, selfless, and graceful in all that you do as a MOTHER. 😍 shopLH thanksgivingdinner begratefuleveryday ladybosses lakehousebabe bestfriendgoals inthekitchen feast donteattoomuch hostingthanksgiving shareyourbest


0💬Normal

In need of an indulgent meat fix? Order our tender, smoky, Josper-grilled Rack of Lamb to share with the table.


1💬Normal

My first time having quiche was when was about 10. My mom had taken me to some kind of girly party, maybe Mary Kay?! The hostess has all these finger foods and snacks out. One looked like a little pie and popped it into my mouth before Mom could say anything.⁠ 👩‍🍳⁠ It was fantastic. Come to find out it was a mini quiche lorraine. I was hooked. Eggs in a pie crust with yummy add-ins spoke to my inner foodie.⁠ 👩‍🍳⁠ Fast forward to me being a grown-ass woman that still gets quiche cravings. This Ham and Cheese Quiche recipe is brunch perfection! Salty bits of ham, tangy cheese, and creamy eggs all bake up to fluffy deliciousness.⁠ .⁠ Be sure to tag BreadBoozeBacon so I can share you in my stories! Recipe is on the blog, link in profile. 😊⁠ .⁠ huffposttaste f52grams foodblogger forkyeah recipeoftheday recipe instayum instafood food foodstagram inthekitchen feedfeed buzzfeast huffposttaste bhgfood yahoofood foodwinewomen foodandwine bonappetit todayfood


0💬Normal

One of my favorite things to do for the holidays is bake! It’s so fun when it’s something I know by heart or it’s a simple recipe and my kiddos can help out too! Easy things like stirring or smashing the bananas for this banana bread are so perfect to have your kiddos get excited to cook and bake along side you too! This is so fun and one of my favorite bonding experiences anytime of the year but especially at the holidays! Something about it just says cozy to me! Let me know in the comments below, do your kids enjoy being in the kitchen? ◽️ ◽️ ◽️ ◽️ mommyandme cookwithmom bananabread holidaybaking baking family familybaking togetherasafamily cookasafamily inthekitchen


3💬Normal

Want a killer recipe to WOW all of your Thanksgiving guests??? Follow questnutrition and checkout this link for the recipe and cooking instructions. http://blog.questnutrition.com/make-room-on-the-table-for-these-purely-perfect-pumpkin-pie-bites/ 🍰 🍮 🍬 🍭 🍫 onaquest questnutrition questprotein questrecipes healthyrecipe healthydessert healthythanksgiving healthy thanksgiving nutrition fitchef fitrealtor fitnessjourney loseweight losefat abrecipe easysixpack fitnessgoals fitfam inthekitchen healthykitchen chefskitchen workouts workout pumpkinpie pumpkin almonds impressive peopleareawesome foodie


4💬Normal

There are a couple things I always reach for and trust to always give me a good outcome in the kitchen.. My perfectly seasoned cast iron skillet and Land O'Lakes butter. 😍 ad Simple, but perfected. Formed in 1921, landolakesktchn has been providing farm-fresh, simple ingredients for almost a century! Try it while baking, sautéing, or use it to enhance your fav cornbread recipe like me. 🙌🏼 Find your new favorite butter at Krogerco today! LandOLakesAtKroger Tell me about your favorite tried and true recipes below!


12💬Normal

Humble Crumble Cakes. 😊😊😊


5💬Normal

Aperitif .. pumpkin bread croutons, fresh milk flakes, taggiasche olives, dried tomatoes, chives.from the decidedly intense and delicious flavor ..[ita] Aperitivando..crostini di pane alla zucca, fiocchi di latte freschi, olive taggiasche, pomodori secchi, erba cipollina..dal sapore decisamente intenso e squisito.. happy instagood foodoftheday foodgasm twelveskip tweegram foodgram instago tflers yum statigram instalike instamood portrait photogram photoshoot photog recipe mealidea myplate kitchenlife inthekitchen homemade dishes positivevibes goodvibes ilovecooking ilovefood iloveeating bestoftheday


2💬Normal

Spaghetti with claims and bottarga of mullet (spicy, parsley and onion's oil)..very yummy..[ita] Spaghetti alle vongole con bottarga di muggine (peperoncino, prezzemolo e olio all'aglio)..una vera bontà!! 🍝 Bottarga is the Italian name for a delicacy of salted, cured fish roe, typically of the grey mullet or the bluefin tuna, frequently found near coastlines throughout the world. The delicacy is often featured in Mediterranean cuisine and consumed in many other regions of the world. The product is similar to karasumi, the softer cured mullet roe from Japan, and to guneoran, the cured mullet or freshwater drum from Korea. It is known as batarekh in Egypt. happy instagood foodoftheday foodgasm twelveskip tweegram foodgram instago tflers yum statigram instalike instamood portrait photogram photoshoot photog recipe mealidea myplate kitchenlife inthekitchen homemade dishes positivevibes goodvibes ilovecooking ilovefood iloveeating bestoftheday


1💬Normal

Today I cooked a special Thai red curry chicken with jasmine rice..aroiiiii..[ita] oggi ho cucinato un tipico piatto thai al curry rosso e riso Jasmine..buonissimooo.. happy instagood foodoftheday foodgasm twelveskip tweegram foodgram instago tflers yum statigram instalike instamood portrait photogram photoshoot photog recipe aroi thai kitchenlife inthekitchen homemade dishes positivevibes goodvibes ilovecooking ilovefood iloveeating bestoftheday


0💬Normal

Special meal for New Year 2019: all cooked by healthy way..black sepia ink rice..big Argentinian shrimps salmon. radish onion yellow sauce. happy instagood foodoftheday foodgasm twelveskip tweegram foodgram instago tflers yum statigram instalike instamood portrait photogram photoshoot photog recipe mealidea myplate kitchenlife inthekitchen homemade dishes positivevibes goodvibes ilovecooking ilovefood iloveeating bestoftheday


0💬Normal

Appetizers top level: segale bread, vegan white cream, tomato, mushrooms, salmon, truffle sauce, aneto..[ita] crostini di pane di segale, crema vegana bianca, pomodoro, funghi saltati, salmone, salsa al tartufo, aneto..un mix di sapori unico. happy instagood foodoftheday foodgasm twelveskip tweegram foodgram instago tflers yum statigram instalike instamood portrait photogram photoshoot photog recipe mealidea myplate kitchenlife inthekitchen homemade dishes positivevibes goodvibes ilovecooking ilovefood iloveeating bestoftheday


2💬Normal

Welcome autumn..special meal.. Vegan bulgur and quinoa with pumpkins, red and yellow corn pepper, zucchini, nutshell..[ita] benvenuto autunno..piatto special..bulgur e quinoa vegan con zucca peperoni rossi e gialli zucchine e anacardi.. happy instagood foodoftheday foodgasm twelveskip tweegram foodgram instago tflers yum statigram instalike instamood portrait photogram photoshoot photog recipe vegan vegano kitchenlife inthekitchen homemade dishes positivevibes goodvibes ilovecooking ilovefood iloveeating bestoftheday


0💬Normal

vapour cooked organic veggies..zucchini and leek..no salt no oil no fry no fat..only the real taste of organic veggies..amazing..healthy.. happy instagood foodoftheday foodgasm twelveskip tweegram foodgram instago tflers yum statigram instalike instamood portrait photogram photoshoot photog recipe vegano vegan kitchenlife inthekitchen homemade dishes positivevibes goodvibes ilovecooking ilovefood iloveeating bestoftheday


1💬Normal

Thai sweet chilli sauce chicken wings with rosemary and Thai mango sauce..chicken was cut and cooked in double steps to keep the healthy cooking style without using oil and fat..taste was sweet and spicy..[ita] Thai alette di pollo piccanti con rosmarino con salsa thai al mango..il pollo è stato tagliato e cucinato in due passaggi per garantire una cottura sana eliminando grassi e senza l uso di olio..il sapore dolce e piccante spettacolare.. happy instagood foodoftheday foodgasm twelveskip tweegram foodgram instago tflers yum statigram instalike instamood portrait photogram photoshoot photog recipe mealidea myplate kitchenlife inthekitchen homemade dishes positivevibes goodvibes ilovecooking ilovefood iloveeating bestoftheday


2💬Normal

..french potatoes and valsoia mayo.. potatoes were cooked into the oven, without oil, without fat..valsoia mayo is totally vegan, no ogm..help to balance cholesterol..taste is the same to normal mayo with eggs..healthy and yummy.. happy instagood foodoftheday foodgasm twelveskip tweegram foodgram instago tflers yum statigram instalike instamood portrait photogram photoshoot photog recipe mealidea myplate kitchenlife inthekitchen homemade dishes positivevibes goodvibes ilovecooking ilovefood iloveeating bestoftheday


0💬Normal


Next Page

#dinner - #recipes - #food - #keto

counter