#kidfriendlymeals

Dinner for Enzo: Quesadilla, avocado, mushrooms, broccoli, tomatoes, bell peppers and cantaloupe 👦🏻 - Little bit of this, little bit of that! kidapproved whatmykideats


1💬Normal

Healthy eats is so versatile even the little ones can enjoy the meal prep 👩‍🍳❤️ kidfriendlymeals mealprep miamimealprep foodie kidapproved yummy healthylifestyle healthykidsfood healthyliving healthiswealth


0💬Normal

Yes! I do have some holiday cheer showing up around the house. This fall weather gives me inspiration to cook again and I have to share my EASY recipe for this Spicy Chicken Bake! Loaded with cauliflower. I promise you, even if you are not a fan of cauliflower, you will love this low carb option for a rich casserole that reheats so nicely! linkinbio recipes cheese keto lowcarb chicken mealprep thesnackplateblogger momblog kidfriendlymeals


0💬Normal

What’s cooking in the IPS Inland Valley kitchen ??? Some delicious Holiday Broccoli Cheddar Soup 🥣☺️ 👉🏻 Beat the cold, the holiday stress, and the potluck mess with this tasty recipe that will become your new holiday favorite ☺️❄️ 👉🏻 let us know what your favorite holiday meal is down in the comments 👇🏻


1💬Normal

Nothing better on a chilly day than a cozy bowl of soup enjoyed in comfy sweats, double tap if you agree! 🥣😍 _ Recipe for these easy chicken and dumplings can be found on my site! Stay warm friends! . . . soup chickenanddumplings easyrecipes f52grams todayfood onepotmeal souprecipe fallfood comfortfood getinmybelly cozyfall cozyvibes eeeeeats imsomartha marthafood bhgfood foodphotography healthyish eat dinner dinnerideas familyfriendlymeals kidfriendlymeals


18💬Normal

The best kind of pasta is the one made with veggies ♥️ (Sorry for the sloppy plate, I was in a hurry!) veggiepasta thegreenmenu kidfriendlymeals veganmeatballs


0💬Normal

I have a confession ... ⠀⠀ The past couple of weeks the thought of cooking for my family has made me want to cry ... this is us going out to eat ... AGAIN. But look how happy I am about it! Lol 😂 ⠀⠀ I am just so tired and exhausted! I had no idea how exhausting being a mom is. NO IDEA. On top of my daily list of 500 things to do, I have to feed two tiny humans, plus my husband, plus myself all day every day ... and it has to be healthy?! 😩 ⠀⠀ Look, no one’s perfect when it comes to healthy eating. We all have days where the thought of cooking a healthy meal for our family makes us want to cry (at least it does me), we all have setbacks, we all feed our kids some not-so-healthy options at times ... you’re not alone! ⠀⠀ What helps so much is planning (which I wasn’t doing the past couple of weeks) and finding ways to make cooking at home quicker, easier, and more efficient. ⠀⠀ Here are my TOP 3 TIPS!🙌🏽 ⠀⠀ 1. LEFTOVERS are life. For example, I make enough dinner to feed us lunch the next day. My husband pulls it out of the fridge in the morning and takes it to work with him - so convenient! 2. PLAN your meals and grocery shop accordingly. This makes cooking throughout the week so much easier (you won’t have to wonder “what do I feed these people?”) and also reduces grocery/food waste. 3. Keep it SIMPLE. Fancy meals are awesome, but they take so much time. A good healthy meal can be as simple as baked chicken (don’t forget olive oil and spices), a baked sweet potato, and steamed (buttered) broccoli. Such an easy, healthy (and yummy) meal! ⠀⠀ ⠀⠀ ⠀⠀ ⠀⠀ ⠀⠀ momlife motherhood motherdaughter healthykidsmeals easyrecipes healthyrecipes toddlerfriendlyfood kidfriendlyfood kidfriendlymeals easyrecipes recipes dinnerideas mealplan mealplansformoms mommeals healthyliving lunchideas kidssnackideas kidssnacks toddlersnacks healthytoddlersnacks snackideas healthysnackideas


0💬Normal

Picky eating tip! Does offering a new food at dinnertime to your toddler or younger kiddo tend to kick up a tantrum?⠀ ⠀ If so, take heart - it's very common. You might have more success if you offer new foods earlier in the day during breakfast, snack and/or lunch. This is because fatigue tends to build up throughout the day in younger children and can make the hours around dinner time particularly sensitive.⠀ ⠀ And don't worry, this part of the process will pass as they grow!⠀ ⠀ If you are struggling with fussy eaters, stay tuned for an online course I'm launching on how to navigate picky eating. It's getting reeeeeeeeally close to LAUNCH TIME! In the meantime, grab my FREE guide to reducing picky eating - link in profile! 👆👆👆⠀ ⠀ I'm curious, would you serve this meal to your kiddos? (Roasted mushrooms and carrots, black beans, shrimp fajita) ⠀ Why/why not? 👇👇👇


5💬Normal

Here’s the adult version of what I packed my kids for lunch yesterday. aidellssausage over a bed of rice + quinoa. Add in an egg and whatever veggies you have on hand and drizzle with sriracha or your choice of sauce. Don’t forget to garnish with fresh cilantro because fresh chopped herbs are EVERYTHING 🙌🌱


2💬Normal

The bold flavor of a marinara sauce makes it easy to add tons of veggies without altering the taste too much. Here I cooked some grass fed ground beef mixed with chicken liver and added onions, carrots, and bell peppers. After the sauce starts to boil, lower the heat and let it simmer to perfection. The veggies also add a natural sweetness that is just 👌🏻. My kids love it! If your kids are super tasters, start with a small amount of liver and increase little by little. I’ll do a post later on the many health benefits of liver. 😄👍🏻


4💬Normal

Thanksgiving VIBES are in full effect over here at livelovepop! Surprise your little ones or your guests with some fun, healthy, popcorn inspired Turkeys 🦃! thanksgiving thanksgivingdecor popcorn sweetandsalty saltysnacks kidfriendlymeals kidfriendlyrecipes vegan vegansnacks nongmo healthylifestyle healthy thefeedfeed marthastewartliving womanownedbusiness giveback missionbased inpopcornwetrust theholidayseason


1💬Normal

Bowls for everyone! Leaf loves to build his own😁🌱🤘 kidfriendlymeals buildabowl nourishyourbody lunch snack dinner fortcollins Alimentary locallyowned


0💬Normal

Maybe your kid likes quinoa, but we're guessing....NOT. Instead, we've put together a round-up of kid-approved burritos, pastas, and tacos so good your kids won't realize it's MeatlessMonday. Check them out on our blog, linkinbio!


2💬Normal

Super simple Mu Shu. Once you’ve sliced everything up and whisked your sauce this comes together in less than 15 minutes. Add a little brown rice or some sliced cucumbers and rice wine vinegar and dinner is on the table. Bonus points for the fact kids love this😊 ********************************* Mu Shu serves 4 1 lb meat or shrimp 1 Tbs oil 3-4 green onions sliced 3 cups thinly sliced cabbage 3 cups sliced mushrooms 2 carrots cut into matchsticks 1/2 cup sliced red or yellow bell pepper 1/4-1/2 cup hoisin sauce 8 standard size flour tortillas ****************************** Sauce 4 Tb soy sauce 2 tsp sesame oil 2 minced garlic cloves 1 1/2 tsp chili garlic paste or sriracha 1 Tb brown sugar 1/4 tsp black pepper Whisk all sauce ingredients in a small bowl and set aside. Over med/high heat brown meat until just cooked. Remove and set aside. It will go back in the pan again for more heat. Add mushrooms to pan, once they start to brown a bit add green onions continue cooking until mushrooms are tender about 3-4 minutes. Add in cabbage, carrots and bell pepper cook another 3 minutes. Return meat and any accumulated juices as well as your sauce mixture. Cook another 2-3 minutes just to combine flavors and thicken sauce slightly. Place a smear of the hoisin on each tortilla and top with meat mixture. nibblennest mushu pork chicken shrimp hoisinsauce easyrecipes easymushudinner itswhatsfordinner easymeals kidfriendlymeals fastasianrecipe fastandhealthyfood sacramentofoodblogger foodblogger foodiesofinstagram foodiesoflosangeles foodiesofsanfrancisco foodiesofsacramento instafood foodfeed bhgfoods dinnerinajiffy


4💬Normal

*Roasted Red Pepper Pasta* Recipe 👉🏼 thepioneerwoman roastedredpepperpasta Simple ingredients and big flavor: (3) red bell peppers + pine nuts + onion + garlic + heavy cream + Parmesan + pasta (I used mini farfalle). My family likes bell peppers, so everyone liked the flavors of this one and was a nice change from mac ‘n’ cheese! audraskitchen pioneerwomanrecipe redbellpepper pasta farfalle dinnerideas mealprepideas mealideas simplerecipes kidfriendlymeals kidfriendlyfood mealplanning mealplanningmadeeasy


0💬Normal

Recuerdo que los viernes solia ir al centro comercial el recreo con mi hermana por unos cinnamon rolls. Pero tambien recuerdo lo fatal que me sentia despues: llena de gases, me sentia “lenta”, hinchada que siempre terminaba con dolor abdominal. Claro, estos queridos rollos estaban llenos de azucar, trigo, y leche. Algo mas?🤷🏼‍♀️ . . Eso no quiere decir que no me gusten! Entonces por aqui les traigo lo que para mi ha sido un sustituto perfecto!!!! INGREDIENTES: 2 tz de harina todo uso sin gluten 4 cditas de polvo de hornear 2cdas de sirop de maple 1/4tz de mantequilla vegan 2/3tz de leche vegetal in azucar Canela y azucar morena para espolvorear PROCEDIMIENTO: Calentar el horno a 400F Mezclar la harina, polvo de hornear, y el maple. Cortar en pequenos pedazos la mantequilla vegan y mezclar/ cortar con dos cuchillos toda la mezcla hasta que tome una textura de arena Agregar la leche vegetal y mezclar hasta formar una masa. Si la mezcla esta muy secam, entonces agregar 1cdita mas de leche hasta que la mezcla no se pegue mas de las manos Colocar la mezcla en un meson enharinado y estirar con un rodillo. Agregar un poco mas de mantequilla derretida por encima Mezclar la canela y el azucar morena y espolvorearla encima de la parte amasada. Comenzar a enrollar Una vez que tengas el rollo formado, cortar al grosor que mas te guste. Hornear por 12-14min o hasta que tenga la textura que te guste. Disfruten!!!!! Alguien como yo que le gusten los cinnamon rolls?? No me dejen sola! 🙈🙈🙈 glutenfree glutenfreediet glutenfreedietitian yourtrusteddietitian onlinedietitian foodsensitivities kidfriendlymeals kidfriendlyfood


11💬Normal

Preschool snacks: Hard boiled eggs, organic grapes, annieshomegrown grahams, steamed carrots, and a onceuponafarm fruit pouch. yumboxlunch preschoolsnacks healthykidsfood kidfriendlymeals bentolunchbox


0💬Normal

TODAY! PhillyCheesesteaks with Fried Onions, Cherry Peppers and Cheddar “Whiz” Vegetarian: Portobello Mushroom & Provolone Soup: Pork Belly and Soy Egg Ramen with Fresh Egg Noodles Order Now LinkInBio


1💬Normal

All everyone is talking about is Thanksgiving, but we still have to cook dinners this week! Our meal plan this week let’s you save room for Turkey Day with 5 low-cal comfort food recipes. How good does this Tuscan Chicken spaghetti squash at gritstogrewns look? . . . mealplanning mealplans easydinnerideas easyrecipes kidfriendlyfood kidfriendlymeals kidfriendlydinner cookingforkids feedingmyfamily coolmomeats dinnerplans recipeoftheday recipeoftheweek bestrecipes easyrecipes favoriterecipes kidsfavorite familyfavorite kidscooking recipesforkids easyrecipes lowcaloriemeals lowcalorie lowcalorierecipes lowcaloriefood


0💬Normal

looking a healthier treat for the kiddos? then you must try this banoffee It's Sweetened with Dulce de leche sauce/Syrup . banoffee dulcedeleche


4💬Normal

Today's color seems to be orange 😁 Yesterday's was green lol. I'm introducing a new lunch item today - sweet potatoes topped with butter and cinnamon sugar of course! It should taste really yummy on this cold rainy day once Mrs. M heats it up 😊 Today's menu : • Sweet potatoes • Salad with lettuce, cucumber, carrot, egg, croutons, cheese and ranch dressing • Strawberry, orange and pineapple medley • Cheez It's • Fruit rollup (not pictured)


1💬Normal

Science says instead of giving toys… give gifts that create memories. They’re valued more than toys 👨‍👩‍👧‍👦 . . . . . kidzshed indoorplaycentre makingmemoriestogether pricelessmoments giftsforchildren toddlergifts shopsmalllove kidfriendly kidfriendlymeals eatinortakeaway glutenfreefoods morningtonpeninsulamums peninsulakids mountelizamums melbournemums


0💬Normal

Got family favorite dishes you would like to enjoy daily but have no time to plan, shop and cook? Worry no more, we offer meal prep service with own menu. Meals will be delivered hassle free to your doorstep, made just as you would. wholesome healthy delicious Simply warm and serve your family their favorites without the kitchen mess, we'll handle that. Email: infosoulportians.co.za with your menu and we'll get cooking.


1💬Normal

I usually like to make my own gf crumb however did not have the time this time round so I gave the orgranfoods gf panko style breadcrumbs a go. So yum! Kids were very pleased with their chicken nuggets paired with roasted sweet potato, guac, broccolini and broccoli sprouts 🥦 Cooked in Jimalie VCO and added some liquid coco oil to the df guac 🥑 glutenfree dairyfree glutenfreechickennuggets kidfriendlymeals guacamole coconutoil healthyfats


3💬Normal

Hello winter 2020 ❄️! Today was one of those days where I just felt cold all day! Winter is often a time of year where our meals become slightly heavier because they often include a higher carb base such as pastas, rice, potatoes, soups and stews, etc. My family loves pasta type meals and quite honestly I 💕 pasta too. This is a true family favorite of ours. Chicken broccoli 🥦 casserole (or hot dish as some call it) it’s so simple and easy to make and can be modified to meet taste preferences or allergies very easily. Not only is this a simple meal and it’s truly nutrient dense and has lots of wonderful foods in it! Comment below if you would like the recipe and want to give it a try! familydinner supper veggies fiber wholegrain pastalover dietitianapproved under30minutemeals glutenfree kidfriendlymeals


1💬Normal

30 minutes from walking in the door to stuffing this in my mouth 👌🏼 ⁣ ⁣ Ground Turkey Tacos are a family favorite in our house. Some of us can’t even wait to get it in the shell. 👀 Got everything I needed from aldiusa except the ortegataco sauce. ⁣ ⁣ tacoseveryday tacosallday ilovetacos tacomonday eatprettythings eatgoodfeelgood eatbetternotless eatyourcolors eattherainbow🌈 eattherainbow kidfriendlymeals kidfood kidfriendlyfood instafeast healthyeah shareyourtable onmykidsplate whatsonmykidsplate blwideas minifoodie momlife momoftwo foodblogeats foodblogfeed delish tasty


4💬Normal

Asian for dinner tonight 🥢 stirred up in less than an hour ⏱ Chicken fried rice 🍚 Chili beef 🥩 Chicken with broccoli 🥦 Yums in our tums 🤤 . . . quickdinner asianfood food kidfriendlymeals yummy momsofinstagram momofthree


1💬Normal

Really quick and simple dinner idea. Quinoa with chickpeas, English cucumbers, onion, arugula, and roasted beets and carrots. Drizzled with homemade dressing: EVOO, fresh lemon juice, pressed garlic, oregano, salt and pepper. Sprinkled with nutritional yeast (for extra protein and B vitamins) and Nigella Sativa (for all of the amazing health benefits) Bon Apetit 😛


6💬Normal

Teriyaki chicken 1/2 cup teriyaki sauce 1 1/2 TBS sugar 1-2 boneless chicken breasts cut up 2 tsp cornstarch 1 TBS oil Cooked rice 1. Dissolve sugar in teriyaki sauce. Put chicken in a gallon bag. 2. Remove 3 TBS of mixture and pour In with chicken and let marinate 15-30 mins. 3. Add water to teriyaki sauce until you have 2/3 cup and mix in cornstarch. 4. Heat oil in skillet and cook chicken for 5-7 mins on med-high heat. 5. Add teriyaki sauce and cook until comes to a boil and begins to thicken. 6. Serve over rice and with veggies. We like it with edamame.


1💬Normal

Italian sausage and vegetable soup. Its winter here in BC and I've had it folks. The blahs are creeping in and it's been a slow weekend. Here's to fighting shitty moods and germ season with real foods. Bonus points for having enough here for dinner plus a week of lunches. SOUP FOR EVERYTHING. souplife lowcarb ketosoup realfood winterblaghs snowdaymeal mondaymealprep eattherainbow soupereasy easymeals madefromscratch norecipe noreciperequired kidfriendlymeals


0💬Normal

Salmon—it’s what’s for dinner! Olive oil, garlic powder, salt/pepper, parmesan cheese, and parsley! Bake at 425 for 10min! dinner dinnerideas dinnertime recipes salmon parmesancrusted delicious tasty tastyfood easy easyrecipes healthyrecipes onabudget budgetmeals familyfavorite toddlerfriendly kidfriendlymeals


0💬Normal

“How do you cook a different meal every single day?” ask so many of you guys⁠ ⁠ Answer: I don’t! 🙅🏻‍♀️⁠ ⁠ I like to meal prep but I’m not very good at meal planning. Although if I'm recipe testing, I know exactly what days we’re going to enjoy the hopefully successful product⁠ ⁠ 💥Here’s my current system:⁠ ✅Cook 2 main dishes for the week. I’ll oftentimes double the recipe to build a freezer stash⁠ ✅Prep individual foods (like wash and chop veggies, cook a batch of grains or lentils, etc.). For veggies, as I mentioned in a recent post, I have a goal of enjoying at least 3 diff. produce from the week before so I pick out whatever looks good at the store. And I'll mostly roast or steam roast them w/various seasonings to enjoy as a side (will share more on this tomorrow!)⁠ ⁠ Then during the week, we enjoy a combination of both composed dishes and a random hodgepodge of whatever’s in the fridge and freezer. I wanted to share this bc what you see here are those 2 meals that I normally make w/the intention of sharing on my blog eventually. Thus, I take extra effort to make them pretty and “perfect.” BUT 70% of the time, our family’s meals look like what you see on the right, a.k.a I’m tired and could care less about presentation 🙈⁠ ⁠ Regardless, I do strive to include some type of protein/fat, carb, fruits and or veggies, at every meal. And I ALWAYS make sure there's at least one food that he loves and feels safe with⁠ ⁠ And then there are days, weeks when this “strategy” gets kicked to the curb bc I get into a rut and feel unmotivated and uninspired. Hello, takeout, PB and J sandwiches, and whatever I can dig out of the freezer. That’s life and we just march on!⁠ ⁠ ❤️Now your turn! I’d love to know what your current strategy is in getting meals on the table for your family? Let's inspire and motivate each other ;). Will you tag a parent who might want to join in on this conversation?


137💬Normal

These big, juicy raspberries were on sale for 0.99 at freshthyme yesterday so I snatched some up! Lila and Gia both love them and Gia made raspberry fingers today 😍. She’s been complaining of a stomach ache lately so we’re cutting back on gluten and dairy a bit. For lunch she had tuna (with mayo and relish) on GF bread, steamed carrots and raspberries. Lila ate lots of tuna too! I’m thankful they both enjoy it. toddlerlunch fingerfoods preschoolerlunch kidslunch tunasandwich raspberries steamedcarrots kidfriendlymeals tuna


0💬Normal

🤩A Healthy Instant Pot Recipe!🤩 • Instant Pot Chicken Tortilla Soup is filled with tomatoes, corn, black beans, and chicken. It is topped with crunchy tortillas, avocados, and a squeeze of fresh lime juice to finish it off. Get ready to try one of the BEST instant pot recipes.😋🙌😋 • I especially love this recipe because the ingredients are pantry staples. On those nights when I do not have anything planned for dinner, this recipe can be a lifesaver. And get this, the recipe is prepped, cooked and served in 12 minutes- plus the time it takes to bring to pressure of course! • Grab the recipe over at CreateKidsClub.com right away! • recipevideos recipevideo instantpotrecipes instantpotcooking instantpotchicken instantpotsoup chickentortillasoup chickenrecipes createkidsclub instapotrecipes


4💬Normal

Jayden loves to cook & mama is trying to get him healthier! So what better way to do it then to find simple recipes that he now needs little to no help with! It builds his self esteem & confidence in himself and he loves to eat what he makes 😁 This is keto breadsticks 😋 Love this boy 💙 ketofriendly keto ketorecipes kidfriendlymeals cooking mamasboy mommysontime mademeamama ketobreadsticks yum healthylifestyle healthyfood


1💬Normal

Not ready for you Monday, but here we are 😑 Today's menu : • Ham & cheese sandwich • Cucumber sticks with ranch • Fresh kiwi and grapes • Red bean mochi • Babybel cheese • Oreo • Honey roasted peanuts


2💬Normal

*Chicken Cordon Bleu* betterhomesandgardens betterhomesandgardenscookbook So simple- just wrap a piece of ham around a slice of gruyere and place inside a chicken breast (use a knife to cut a pocket). I then coated the chicken in flour + egg/water + panko and baked covered for 40 min @ 350•. I topped with the cheese sauce from the recipe (butter + flour + milk + cheese). Served with a pre-mixed Caesar salad! It had great flavor, and loved the crunch of the panko. You pan-fry it for a few minutes prior to baking in the oven to get the crispy outside. audraskitchen dinnerideas simplerecipe chickencordonbleu kidfriendlymeals kidfriendlyfood mealplanning mealsmadesimple


2💬Normal

🍎 Cinnamon apple baked oatmeal bites 🍏 . Ingredients * 4 cup of oats * 3Tbsp flax seed meal * 1Tbsp baking powder * 2Tbsp ground cinnamon * 2tsp nutmeg * 1/2 teaspoon salt * 2 cup coconut milk (or your fav milk) * 3 eggs * 1 cup unsweetened applesauce * 1Tbsp vanilla extract * About 2 cups peeled and diced apples - I used honey crisp - Directions: * Preheat the oven to 350F * Grease your muffin tins (I used avocado oil spray) * In a large bowl, whisk the wet ingredients until mixed * Add dry ingredients to the bowl and stir well * Fold in apples * Spoon mixture into each muffin tin, fill to the top * Bake for 25-30 minutes, when tops are crisping and the muffins are set - makes 24 muffins * Remove from oven and let cool completely ~~Serve warm by themselves or enjoy with a smear of butter and some extra cinnamon even some honey makes these extra scrumptious.... or a dollop of PB! Ok now I’m hungry 🤤. - I just made a batch of these for my neighbor who just added a little boy to their family 🥳 These are EXCELLENT new mom muffins! Full of protein, fat and carbs 2-3 of these little guys make a whole meal! Plus they include oats and flax which is thought to help milk supply! I always found breakfast was the hardest meal to make with a new little one and skipping breakfast is not ideal for new moms especially when trying to breastfeed! These are also great for people with allergies since they’re dairy, nut and gluten free! Plus no added sugar! I make a large batch every once in awhile and freeze. Sometimes I will switch up the fruit component, I like to use bananas and walnuts, blueberries or the rind of an orange and cranberries depending on the time of year! Let me know what you think! . . . . . . ______________________ easyfastrecipes kidfriendlymeals breakfastonthego rdapproved recipeshare muffinrecipe raisingintuitiveeaters appleseason quickhealthymeals quickandhealthy newmom postpartumfood postpartumcare selfcare dontskipbreakfast breakfastsnack neighbor beagoodneighbor dairyfreerecipes glutenfreerecipes allergyfriendlyfood breastfeedingrecipes increasemilksupply noaddedsugar


10💬Normal

Looking for finger-foods and easy appetizers for the holidays? These mini Meatloaf & Mashed Potato “cupcakes” from chefbryanwoolley are your answer. Get the full recipe here! Ingredients: • 2.5 pounds ground hamburger • 1 cup Italian seasoned bread crumbs • 2 eggs • 2 cups shredded cheese • 2 tsp garlic salt • 1 tbsp ground pepper • 3 cups mashed potatoes, cooled • Cherry Tomatoes • Finely chopped parsley Instructions: • Preheat your oven to 350 degree’s. • To a large bowl, add the ground hamburger, seasoned bread, eggs, shredded cheese, garlic salt and ground pepper. Mix everything together until combined. • Line a cupcake tin with cupcake liners and fill each cupcake liner up with the meatloaf mixture. • Bake in your pre-heated oven for 25-30 minutes or until the hamburger is fully cooked through. • While the meatloaf cupcakes are baking, place the prepared and cooled mashed potatoes in a piping bag with a large star tip. • When the meatloaf cupcakes are cooked, remove from the oven and allow them to cool. I poured the excess grease into the garbage. • Place the cooked meatloaf cupcakes into a second cupcake liner that isn’t greasy. and pipe the mashed potatoes on top like you would frosting. • Place a cherry tomato on top of each meatloaf cupcake and sprinkle with finely chopped parsley. Serve and enjoy!


2💬Normal

Happy Monday from Tom Turkey 🦃 (or...whatever you see him as 🤷🏼‍♀️) Watch my stories for what my kids thought it was 😂 sorrythanksgiving itried And a very happy Veterans Day to all those who sacrificed for our freedom! May we never take it for granted! 🇺🇸 . . . . magicmama thanksgiving turkeyfood playwithyourfood oandjbreakfasts turkeycinnamonrolls thanksgivingfood thanksgivingdecor thanksgivingdinner kidfriendlymeals kidfriendlyfood


61💬Normal

Extremely simple and delectable, try this recipe for an ultimate side dish, tantalizing appetizer, and fulfilling snack. The Garlic Rosemary One Step...Done!™ Potatoes combine the best tasting potatoes with the most innovative packaging availability for true convenience. There’s no washing, seasoning, puncturing, or poking involved - microwave for six minutes!


3💬Normal

✨LUNCHBOX INSPO✨One of the hardest things about being a parent is trying to figure out what the heck to pack your kid for school lunch 🤔 Amirite? So many things to take into consideration: Food allergies? Will they eat it?...Will it stay warm til lunch? How much time/effort is this going to require? Should I prep it in the morning or before bed? Ice pack or no ice pack? THE STRUGGLE IS REAL. . Today’s menu: aidellssausage smoked chicken sausage. 🔸all natural 🔸no nitrates 🚫 So there’s that to feel good about 🙂❤️👍🏼👌🏼 . I cooked the sausages on my cast iron pan, sliced diagonally and and laid them over a bed of rice + quinoa (3 cups white rice + 1 cup quinoa + 5 cups water). I recommend prepping it all the night before because who knows what the morning will bring. . . COSTCO INGREDIENTS: 🛒 aidellssausage 🛒 pretzelcrisps (for snack) 🛒 Kirkland quinoa 🛒 Kukuho Rose rice 🛒 Costco fruits + veggies


10💬Normal

Potatoes and Mexican food are two of my favorite things, so I decided to combine them in this delicious ✨Cheesy Potato Taquito✨ recipe! 🥔 They’re kid friendly, adult friendly and freezer friendly! Serve them with your favorite dip and enjoy as an easy and tasty dinner or snack! 🥔 https://sproutingwildones.com/cheesy-potato-taquitos/ . . . taquitos mexicanfood potatoes freezermeals vegetarian vegetarianrecipes glutenfree glutenfreerecipes kidfriendlymeals kidfriendly kidfriendlyfood toddlermeals blw blwideas babyledweaning babyledeating healthy healthylifestyle healthyfood healthyrecipes eathealthy eathealthyfood healthykidsfood healthykidsmeals healthykids snack healthysnacks dinner dinnerideas huffposttaste


17💬Normal

pranzul de azi - CHIFTELUȚE CU CARNE DE PUI ȘI SOS DE ROȘII Se poate oferi la masa de prânz a bebelușilor de peste 8 - 9 luni. Ingrediente pentru chifteluțe: 150 g carne de pui 1 morcov 2 căței de usturoi 2 - 3 fire de ceapă verde 1 ou 1 cartof 1- 2 linguri de pesmet Câteva fire de marar și pătrunjel Pt sos: 1 morcov 1 ceapă 2 căței de usturoi 200 ml sos de rosii (sau 2-3 roșii proaspete) 150 ml apă Mod de preparare: Tocăm carnea, dăm morcovul, cartoful prin razătoare mică și îi surgem de excesul de apă. Într-un bol punem carnea, cartoful, morcovul, usturoiul, ceapa, verdeață tocata și în funcție de consistența compoziției mai adăugăm pesment. Modelăm chifteluțe, le așezăm pe o tavă tapetat cu hârtie de copt și băgăm tava în cuptorul preincalzit la 180 de grade pentru aproximativ 30 de minute. Într-o tigaie cu o lingură de ulei de măsline și o ceașcă de apă  înăbușim ceapa, usturoiul și morcovul pentru 6 - 7 minute. Adaugăm sosul de roșii, apa și chifteluțe scoase din cuptor și lăsăm tigaia pe foc pentru 30 de minute. La final adăugăm puțină verdeață tocată mărunt Poftă bună! 🤗


8💬Normal

If you know me you know that I love my carbs 😁 but I have been trying to cut back on them lately and we’ve really been enjoying cauliflower rice! 💚 I created this ✨Broccoli Cheese Casserole✨ using cauliflower rice and an almond topping to make it more of a vegetable dish and not so heavy. 💚 Full recipe here: https://www.shelikesfood.com/broccoli-cheese-casserole/ . . . casserole lowcarb lowcarbrecipes lowcarbdiet lowcarblife keto ketomeals ketorecipes ketodiet vegetarian vegetarianrecipes glutenfree healthylifestyle healthyfood healthyrecipes healthyeating eathealthy eathealthyfood kidfriendlymeals kidfriendly kidfriendlyfood cleaneating eatclean plantbaseddiet plantbased thekitchn feedfeed huffposttaste todayfood


6💬Normal

Make Mac & Cheese Monday a thing! 🧀 This is one of the easiest and quickest instantpotrecipes! If you’re intimidated or afraid to use your Instant Pot, start here! 👆🏻Super simple prep and only 5 minutes⏰on high pressure stands between you and a creamy bowl of mac & cheese! 🤤So what are you waiting for? Go get started! 👩🏼‍🍳 tap link in bio or visit bushelandapeckitchen blog for the full recipe 👩🏼‍💻easyweeknightmeals macaroniandcheese kidfriendlymeals comfortfood


9💬Normal

Can I get a pizza these zucchini bites?! 🍕🤤🙌🏻⁣ ⁣ Ditch the dough, and welcome the veggies! Spruce up your zucchini with some sauce, cheese, and any additional topping you please!! ⁣ ⁣ These mini pizza bites are a simple and nutritious alternative to enjoying the “real” deal. They are low in fat and carbs, while packing in fiber, vitamins, and minerals! ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ mealswithmorghealthygirlzuchinnihealthylifezuchinnipizzahealthyswapshealthyrecipespizzalowcarbpizzalowcarbrecipesffactorapprovedfibersmartgirlseatfiberyummynutritionglutenfreeglutenfreerecipeskidfriendlymealskidfriendlyfoodpizzabitesfoodbloggerfoodphotography


0💬Normal

If protein and getting my chocolate-fix can happen at the same time, that’s the kinda life I want. 🙋🙋🙋 Even BETTER? Kids can “help” with this recipe because it’s SO easy.. And it’s designed to contain nutrition their bodies need! (WIN-WIN for all of us!) The word “protein” might not get my kids as excited as I get, but we ALL get giddy for chocolate! If you want our special recipe, LIKE or LOVE this post and it’ll be in your inbox!! 🍫✅ recipeshare healthyrecipes healthylifestyle easyrecipes quickrecipes paleorecipes proteinrecipes chocolate🍫 kidfriendlyrecipes thekidslovethem recipeoftheday kidfriendlymeals kidfriendlyfood kidfriendlyrecipes kidsloveit whodoesntlovechocolate healthyliving fitmom fitspo joinmetoday winwin healthyeating eatgoodtastegood chocolateheaven heavenlychocolate recipesharingiscaring proteinrecipes proteinfilled proteindessert makemoneyfromhome


1💬Normal

Making your own lunchbox snacks needn’t be fancy or time consuming. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ A quick batch of simple oatmeal cookies will really only set you back 5 minutes of hands on time and often no more than 10-15 minutes in the oven. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ I love this recipe as it is ridiculously versatile and can use up random bits and bobs leftover in the pantry such as seeds, dates, tanies (sultanas) or some exotic berry you tried for a dessert that no one ate. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ It also has the added bonus of a substantial amount of rolled oats which are a good source of fibre. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Head over to the blog (link in bio) for this simple oatmeal cookies recipe (perfect for lunchboxes AND dipping into a cuppa!). To make your life easier, just drop a ❤️ into the comments, and we'll DM you the recipe 😃 Thanks to the lovely Mandy from littlepeoplenutrition for contributing this recipe to our blog! 🤗 . . . . kidfriendlymeals schoollunchideas whatmykideats whatmytoddlereats easydinners oatmealcookies cookiesrecipe feedingkids funfoodforkids schoollunchbox bentolunchbox lunchboxlove homemadelunch lunchboxinspo bakingwithkids toddlerlunch whatifeedmykid kidfriendlyfood familymeals quickdinnerweeknightdinner cookingforkids healthykidsfood kidsfoodideas foodforkids kidslunch bentoboxlunch kidsbento kidapproved


6💬Normal

- NOURISHING BOWL - Dinner tonight was YUM! We tried out the Hoisin Pork Bowl and it was delicious. We will definitely be making this one on a regular basis over summer. It requires very little cooking and was super fast to make. The combination of fresh salad items and herbs with the hot pork and rice was beautiful. I did make a few adjustments to suit our family - nut free, so we skipped the peanut part. We also skipped the sambal oelek to make it kid friendly. I served sriracha as a side for the adults to provide a bit of a kick. The mini mixers had a bowl of rice, pork and broccoli and asked for seconds - yes! FIND IT - Cookidoo - Nourishing Bowls - Hoisin Pork Bowl . . . . . . . . thermomix thermomixaustralia cookidoo nourishingbowl pork hoisinpork rice freshherbs salad buddahbowl dinner dinnerinspo dinnerinspiration kidfriendlymeals kidfriendlyfood kidfriendlyrecipes summerdinner


0💬Normal

Our first time visit to Korean Burger Bistro burgerplussg trying out their New Breakfast Menu! Happy kids with their happy kid's meal that comes with a mini burger and all time favourite fries and the moms love it that the drink that accompanied the meal is milk in the hippiest might bulb bottle with dancing lights! Tell me about it, belandbray and myself are totally suckers for such bottles! Kid's Meal choices, $10.50 per set: 👉🏻 Mini Cheese Burger 🧀 👉🏻 Mini Bulgogi Burger 🐮 👉🏻 Mini Chicky Burger 🐔 👉🏻 Mini Fish Burger 🐟 Breakfast like champion, we tried the following (Slide to the left) : Egg Toast Beef Bulgogi, $9.50🐮 Egg Toast Bacon & Cheese, $7.50 🥓 🧀 Egg Toast Avocado, $8.50🥑 Choose to top up for a cup of brew or just go ala carte. I heart the classic bacon and cheese and fluffy brioche that sandwiched it. While Xav raved about the beef bulgogi that was made fresh with minced beef, fragrant fried onions, Burger+ signature bulgogi sauce, sweet luscious premium dressing and a runny egg egg sits atop the breakfast toast. Burger+ is sure to be generous with the milk drizzled over it, I will probably request to have it in lesser amount. 😋 Burger+ breakfast menu is not only available for breakfast only! It is available from 8am to 5pm daily! Thank you genecosg burgerplussg for the invitation. MediaInvite MediaTasting BurgerPlusSg Burger Toast MoreThanJustaBurger AllDayBreakfast WismaAtria KoreanRestuarant SgRestaurant Foodiegram FoodieSg Foodstagram Foodphotography Instafood SgFood Foodpics SgfoodTrend whatwe8today Sgkids Sgfamily Kidsfriendly Sgbloggers KidFriendlyMeals FamilyFriendly VisitSingapore ExploreSingapore InstaSg Sg


8💬Normal

It’s perfectly ok not to cook a dish. I often forget that and up spending 40mins cooking a saucy meal only to spend another 20mins convincing my little guy to try it. A raw, picky plate is a great break from all of that. Filling, quick to make and full of goodness. 📸 heidiapples . . . hummus whitebeandip snackplate toddlerfood toddlerlunch toddlerfoodideas kidfriendlymeals kiddriendlyfood healthyfamilymeals realfamilyrealingredients


1💬Normal

Stir some pesto through some cashew cheese, dump it in some pre-cooked pastry shells and top with cherry tomatoes. Nifty cherry tarts courtesy of rebelrecipes ✅ . . . cashewcheese tomatotart tart tomatoseason pestotart pizza rawveganpizza veganpizza vegetarianpizza vegantart veganfood kidfriendlymeals healthyfamilymeals healthykidsfood healthykidsmeals


2💬Normal

It's Sunday Night Pizza Night! We're using gluten free pizza crust made with cauliflower, a gluten free pizza sauce spiced up with Pampered Chef's Italian Seasoning Mix. One pizza is topped with Canadian ham, pineapple, green peppers and a mix of shresded sharp white cheddar and mild cheddar. The second pizza was topped with a layer of mixed chopped ham, minced garlic, chopped onion and chopped green peppers, a layer of pepperoni, and a layer of shredded cheese mix seasoned with Pampered Chef's Sweet Basil seasoning mix. ... YourPamperedFoodie kitchencreations freshfood familydinner familytable glutenfree dinnertable dinnertonight pizza pizzanight kidfriendlymeals


0💬Normal

Pumpkin and cinnamon eggy bread 🥖 A simple and yummy breakfast today, served with vanilla dipping yoghurt, strawberries and watermelon. ✅ - Recipe: 1 egg, 1 tablespoon of pumpkin purée, dash of milk, sprinkle of cinnamon and 2 slices of wholemeal bread. - Method: mix all wet ingredients and cinnamon together, place bread into mixture and coat well on both sides. In a medium heated non stick pan, place the bread in there and cook until golden brown on both sides. Serve warm with butter, dairy free spread or on its own. - - blw blwideas blw6months frenchtoast eggybread babyleadweaning babyfood babyledweaningrecipes blwrecipes breakfast blwbreakfast pumpkin cinnamon toddlerfood familyfriendlymeals kidfriendlymeals kidfriendlyfood kidseat healthyfood healthyrecipe healthychoice yummy yummyfood


1💬Normal

M I N I P L A T T E R S 👦🏽🧒🏼👧🏻👶🏻 It’s Absolutely perfect weather for picnics with your little ones down at the park!! Mini Fruit & Cheese Platter Boxes available for just $25.00!!! Seasonal fruit, tasty cheese & crackers all packed ready to go!! Add some Chocolate 😋 for just $5.00! 📸 misscant1 at Miss Scarlett’s Birthday Party last month 🎀🎈🌸 picnic park picnicdate picnicday playtime sunshine spring thegreatoutdoors food foodie foodstyling foodstylist platterbox fruit cheese healthylifestyle healthyoptions kidfriendlymeals kidfriendlyfood kids yummy morningtea afternoontea playdates birthdayparty kiddieplatter wattaplatter


0💬Normal

We’ve gone, we’ve tasted and we’ve rounded up the best eats at Epcot Food and Wine Festival 2019. 🤩 And the (ad) Steakhouse Blended Burger 🍔 is tops— a blend of chopped mushrooms 🍄 and beef patty topped w cheese, crispy potato chip, and arugula on a brioche bun. mushroomcouncil So good! Have you tried a blended burger yet? I’d love to know your favorites from Food & Wine this year. For more of our favs head on over to the blog. epcotfoodandwinefestival epcotfoodandwine epcotfood foodandwinefestival2019 besteats kidfriendlymeals


4💬Normal

I’m more of a recipe follower than recipe creator, so I’m extra proud of these turkey burgers I’ve been making lately. They came about all because I had leftover veggies from my csa that I didn’t know what to do with! . 1lb ground turkey 1 egg 1 inch ginger minced 1 clove garlic minced 1 jalapeño, diced 3 scallions (white part), sliced 1 tablespoon liquid aminos 3 tablespoons almond flour Salt and pepper to taste Mix and cook on a pan (covered) with avocado oil 6 minutes each side . I’d also like to give a shout out to Japanese sweet potatoes because they are my everything. Cut into fries, tossed in avocado and salt, bake at 400 for 40 minutes, flip halfway through


6💬Normal

Kids fried rice! 😋 Treat your little ones to a nice dinner out - we have plenty of kids friendly options 👍 pair their yummy dinner with a kids size drink and a sundae as a sweet treat 😍 kidsmeals thai vietnamese familyfriendly yummy asianfusion lunch dinner friedrice kidfriendlymeals


0💬Normal

Toddler dinner for the week (with a side of Chobani greek yogurt cup) 😊 Organic Italian meatballs (diced), organic peas, organic carrots, all mixed into turkey gravy 👍🏼 mealprep kidfriendlymeals nutrition vegetables protein healthylifestyle mealideas quickmeals lunch dinner foodstagram


0💬Normal

ᴄᴀᴜsᴇ sʜᴇ ᴄᴏᴏᴋɪɴ ᴏɴ sᴜɴᴅᴀʏ ɴᴏᴡ ᴀɴᴅ ᴡᴇ’ʀᴇ ᴏᴋᴀʏ ᴡɪᴛʜ ɪᴛ 👌🏼📝🖤 ᴄʜᴇғ elliottedavis ʜᴀs ᴡᴀɴᴛᴇᴅ ᴛᴏ ᴄᴏᴏᴋ ᴀʟʟ ᴛʜᴇ ᴍᴇᴀʟs (ғᴏʀ ᴜs) ɪɴ ᴀ ᴅᴀʏ, ғᴏʀ ᴀ ᴡʜɪʟᴇ ɴᴏᴡ. ʏᴇs, ᴀʟʟ ʙʏ ʜᴇʀ sᴇʟғ. ᴛᴏᴅᴀʏ, ɪ sᴛᴇᴘᴘᴇᴅ ᴏᴜᴛ ᴏғ ᴛʜᴇ ᴋɪᴛᴄʜᴇɴ ᴀɴᴅ sʜᴇ sᴛᴇᴘᴘᴇᴅ ɪɴ. chefinelliotte 👩🏼‍🍳 sʜᴇ ᴡᴀɴᴛs ᴛᴏ ᴏᴘᴇɴ ʜᴇʀ ᴏᴡɴ ʀᴇsᴛᴜʀᴀɴᴛ, ғᴏʀ ғᴏᴏᴅ ᴀɴᴅ ғᴀsʜɪᴏɴ, ᴡʜᴇɴ sʜᴇs ᴏʟᴅᴇʀ. ʜᴏᴡ ᴄᴜᴛᴇ ɪs ᴛʜᴀᴛ? sʜᴇ ᴇᴠᴇɴ ᴛᴏᴏᴋ ᴏᴜʀ ᴏʀᴅᴇʀs ᴀɴᴅ ᴄʟᴇᴀɴᴇᴅ. 🥰 sᴛᴏʀʏ ʜᴀs ᴍᴏʀᴇ


1💬Normal

Opening happy mail today! Unboxing our seasonal selection therottenfruitbox from therottenfruitbox - thank you! We love the snacks and the idea and message of this company! Check them out! sustainableliving sustainablefood kidfriendlymeals kidfriendlysnacks cutekids therottenfruitboxunboxing reducefoodwaste kidapprovedfood babyapprovedfood


2💬Normal

Breakfast Idea! 🤗🤗 Pillsbury Crescent Rolls Jimmy Dean Turkey Sausage Crumbles Eggs and Milk Season to taste. -Un-Roll the crescents, cut each triangle in half Spread sausage over rolls and tools each one up, place in greased pan Beat eggs and milk, season (I used 6 eggs and 1/2 cup cashew milk but in hindsight next time I’ll use more milk and beat them with a mixer) Pour over rolls You can sprinkle with cheese or veggies. Maybe green onion and broccoli 🤷‍♀️ Bake 20-30 mins until egg is fully set dairyfree indulgence breakfast jimmydean pillsbury cooking nowhey eggs brunch nomilk eat food recipe kinda homemade kidfriendlymeals familymeal


0💬Normal

Looking for some tea time snack ideas? A rice and jaggery sweet, the neyyappam is a popular snack in Kerala. My boys love to have these after they come back from school. . Find the full recipe and many more authentic tea time snacks in my award winning cookbook-"4 o'clock Temptations of Kerala" which was titled as the “Best Indian cookbook in the world “ in 2016 Link: http://nimisrecipes.com/my-cookbook/ . . . . nimisrecipes authentickeralacuisine sweetcravings neyappam kerala kidfriendlyfood kidfriendlymeals eveningsnacks cookbook authorlife cheflife awardwinning malayali neyyappam keralatourism foodiesofinstagram cookbookauthor teatime palaharam


4💬Normal


Next Page

#dinner - #recipes - #food - #keto

counter