#tarifler

lezzetli tarifler


0💬Normal

gonulefederin 🍃 Akşam yemeği önerisi🍃🍃 . 1 adet kuru soğanı, 3 adet sivri biberi küçük küçük doğrayıp tencereye koyuyoruz içine az sıvıyağ ekleyip kavuruyoruz. 1 adet büyük boy domatesin de kabuklarını soyup doğrayıp tencerenin içine ekliyoruz 1 yemek kaşığı salça da ekleyip kavurmaya devam ediyoruz.daha sonra küçük küçük doğranmış etleri de ilave edip karıştırdıktan sonra sıcak suda ekleyip pişmeye bırakıyoruz. Tuzunu da yemek pişmeye yakın atıyoruz. . Yanında da pilav ve cacık✔️ . Afiyetle🍃 : : : : poğaça pogaca ankara mutfak pasta kek tatlı tatli tatlıtarifleri çikolata kurabiye tatlitarifci tatlitarifci kektarifi kektarifleri çikolatalı yemek yemektarifleri yemektarifi tarif tarifler sunum istanbul sunumlar kolaytarifler pratikyemekler pratiktarifler lezzet nefisyemektarifleri brek


0💬Normal

Badem ve karamel sosun muhteşem uyumu ile harika bir tarif👌🏻 kaydetmeyi unutma,karamel seveni etiketle😁🌸 .😍❤😍❤ . . Malzemeler Karamel sos için 1 su bardağı şeker 1 buçuk yemek kaşığı tereyağ 1 paket krema 200 ml kullanılıcak Kek için 3 yumurta 1 su bardağı toz şeker 1 çay bardağı ılık su 1 su bardağı sıvıyağ 1 çay kaşığı tarçın 1 paket kabartma tozu Yarım su bardağı kavrulmuş file badem veya ceviz de ekleyebilirsiniz. 3 adet elma 2 tanesi soyulup küp küp doğranacak ve 2 buçuk su bardağı undan 2 yemek kaşığı alınıp küp küp doğranmış elmalar şöyle bir karıştırılacak. (Elmalar dibe çökmesin diye meyveli keklerde bu işlem dibe çökmesini engelliyor) Kalan bir adet elmayı da videodaki gibi kek kalıbının tabanına yerleştirin. Üzerine karamel sosu ilave edip hazırladığımız kek harcı üzerine dökülüp 180 derecelik fırında tamamen pişene kadar tutulur. En son kürdan testi ile pişip pişmediğine mutlaka bakın derim. (Kek hazırlanışı yumurta ve şeker çırpılır. Önce sıvı malzemeler su sıvıyağ ilave edilir. Sonra mutlaka elenmiş un ve kabartma tozu ilave edilip pişirilir. Afiyet olsun . sukrankaymak . spor yemek salatatarifleri çorbatarifleri cahidesultan mükemmellezzetler etyemekleri sütlümutfak nefisyemektarifleri pratikbilgiler yemekpişti sunum sunumnemlidir ankara istanbul 10marifet mutfak pasta yemektarifleri yemektarifi tarif tarifler pratiktarifler peterpan11 ucak5deryaa tren9014


0💬Normal

Repost fadisinmutfagi • • • • • • Keyifli haftasonlarını kızlar nasıl geçiyor gününüz yarin kahvaltıya yapacağınız Harika bir tarif kaydetmeyi unutmayın canlarim 🤗🤗🤗 fadisinmutfagi ozlemdemirdovenkok kahvaltıya yakisacak firinda yumurtali ekmek😍👍 4 yumurta İstediğiniz miktarda Sucuk (kullanmayabilirsiniz ama yakışıyor) 3-4 tane ince doğranmış biber 1 silme çay kaşığı tuz Biz iki türlü peynir kullanıyoruz yarım su bardağı tulum yarım su bardağı kaşar peyniri Yarım çay bardağı süt Yarım demetten az maydonoz Yarım demetten az dereotu 1 çorba kaşığı zeytinyağı İsterseniz sosis ekleyebilirsiniz ya da bunlardan hiç birimi kullanmayabilirsiniz Tost ekmeği kullandık biz tüm malzemeleri karıştırıp ekmeklerin üzerine sürdük fırının en üstüne koyuyorum ve sadece üst bölümünü açıyorum diğer türlü yaparsanız sert olur bu çok yumuşak oluyor mutlaka fansız fırın kullanın 180 derece üstü kızarana kadar pişiyor 😊❣️ Alın size mis gibi anne tarifi 🙈 poğaça pogaca ankara mutfak pasta kek tatlı tatli tatlıtarifleri çikolata kurabiye tatlitarifci tatlitarifci kektarifi kektarifleri çikolatalı yemek yemektarifleri yemektarifi tarif tarifler sunum istanbul sunumlar kolaytarifler pratikyemekler pratiktarifler tasarimtarz


0💬Normal

mutfaktv_tr EN ETKİLİ VE BASİT DOLAP TEMİZLİĞİ Mutfak dolaplarını hızlıca temizlemek için yöntem basit. 1 adet bulaşık makinesi tabletini sıcak suda eritip mutfak dolabının yüzeyini silin. Burada dikkat etmeniz gereken tek şey rengi akacak bir dolaba sahipseniz bunu denemeyin. Siz bu yöntemi hiç kullandınız mı kızlar? • Keşfetten gelenler takip etmeyi unutmayınız 👉🏻 mutfaktv_tr 💥 • ❤️Emeğimize destek olmak için sayfamızı takip ediniz lütfen ❤️ 💐mutfaktv_tr 💐mutfaktv_tr 💐 • ❗️ Arkadaşlarınızın öğrenmesi için de yoruma etiketleyiniz 💕 • 💥 Bu bilgileri kesinlikle kaydedin bir gün işinize yarabilir 👏🏻 • • mutfaktv_tr tarifler pratiktarifler kolaytarifler nefis nefistarifler nefisgram nefisyemektarifleri lezzetlitarifler lezzetgram lezzetlerim lezzet sahanelezzetler mukemmellezzetler yemek yemektarifleri yemekteyiz sunum sunumnemlidir sunumgram istanbul ankara izmir


0💬Normal

Neşeli hafta sonlarınız olsun inşallah😌 Sıcaklar diz boyu devam ediyor😃evimizin dibinde deniz var ama üşendiğimden oraya da gitmiyorum😬evde pineklemek hosuma gidiyor😅 Kimler benim gibi🤔🤦 Neyse tarif gelsin👌 😋😋😋bernaveailesi 🌹HİNDİSTAN CEVİZLİ LOKUM KURABİYE🌹 250 gr yumuşak margarin 1 su bardağı pudra şekeri 1,5 su bardağı hindistan cevizi 2 yemek kaşığı buğday nişastası 1 yumurta 1 yumurta sarısı Yarım su bardağı sıvı yağ 1 paket kabartma tozu 1 paket şekerli vanilya Yeteri kadar un Kalecik Bulamak için 1 yumurta akı ve hindistan cevizi Yapılışı: Un hariç tüm malzemeyi derin bir kaba alın. Yoğurmaya başlayın. Yavaş yavaş un ilave ederek yumuşak bir hamur hazırlayın. Hamurdan ceviz büyüklüğünde koparın ve yuvarlayın. Önce yumurta akına sonra hindistan cevizine bulayın. Yağlı kağıt serili fırın tepsisine dizin. Önceden ısınmış 170 derece fırında beyazlığını kaybetmeyecek şekilde pişirin. . . . . . . . recipes kitchendesign delicous foodblogg keşfet vscofood yemek yemektarifi yummy tarifler pratikyemekler kolaytarifler lezzetlisunumlar tatlı nefisyemektarifleri regran nefisgram


0💬Normal

~KAKAOLU FISTIK EZMESİ~ Ben fıstığın yarısını sade, diğer yarısını kakaolu yaptım. . Kakaolu için malzemeler : 250 gr kabuklu yer fıstığı 3 kare bitter çikokata 1 buçuk yk bal 1 tatlı kaşığı kakao . Sade fıstık ezmesi için malzemeler : 250 gr kabuklu yer fıstığı 2 yk bal . Kabuklarından ayıkladığım fıstıkları tavada kavurdum. Soğuduktan sonra rondodan geçirdim. ( ayrıntılar için püf noktalarıyla fıstık ezmesi postuna bakabilirsiniz) Fıstık ezmesinin bir kısmını sadece bal ekleyerek tekrar çektim. Diğer kısmına ise kakao, bal ve çikolatayı ekledim kıvama gelene kadar dinlendirerek çekmeye devam ettim. . İsterseniz tatlandırmadan da yapabilirsiniz. . Fıstık ezmesinin tok tutucu, enerji verici özelliği var, aşırıya kaçmadan 🙈 diyette tüketebilirsiniz. Çocukların ise çokokrem ve Nutella yiyeceklerine böyle temiz ve sağlıklı bir besin yemeleri daha faydalı olacaktır 💕🙂 . # malzemeyi az tuttuğumuz için 100 er gram çıkıyor, deneme amaçlı yapabilir sonra 2 katı ölçü ile yapabilirsiniz.


1💬Normal

Yumuşacık bayatlamayan poğaca tarifi ve şekilleri 🥰 . . aysens.kitchen . . (Iki tepsilik) Malzemeler: Bardak ölçüm 220 ml 1 subardagi siviyag 1 subardagi ilik süt 2 yumurtanin beyazi (sarisi üzerine) 1 maya 1 kabartma tozu 250 gr quark (20 % lik) / veya süzme yogurt 2 tepeleme yemek kasigi seker 1 silme yemek kaşiğından daha az tuz Aldigi kadar un (220 ml lik bardak ile yaklasik 6 bardak un) Arasi icin istege bagli beyaz peynir Hazirlanisi: Yogurma kabina un haric diger malzemeler alinarak karistirilir. Un azar azar eklenerek yogrulmaya baslanir. Hamur sert olmayacak. Yumusak bir hamur olsun elimize yapismasi gectigine tamamdır. Hamuru üzeri kapali 30-45 dakika dinlendirin. Mayalanan hamuru tekrar yogurmadan yani söndürmeden mandalina büyüklüğünde parcalar alip elimizle biraz acalim, icine beyaz peynir koyup sekil verelim tepsimize dizelim. 30 dk kadar da o sekilde beklesin tepsi de mayalansin. Son olarak üzerine yumurta sarisini sürelim . Istege bagli cörek otu susam serpelim. Önceden ısıttığımız 200-220 derece (ben 210 derecede pişiriyorum) fırında kizarana kadar pisirelim. . . . amazingtavukkeşfet iftar ramazan yemek tarif tarifler pratiktarifler kolaytarifler sunum sunumnemlidir lezzetlisunumlar tatlı tatli tatlıtarifleri pasta kek çikolata kurabiye çikolatalı nefisyemektarifleri poğaça pogaca hamurisi brek borek afiyetolsun


3💬Normal

Kampta en lezzetli ve en kolay yemek tabiki sucuk ekmek🙇🏼‍♀️ Nitrit ve nitrat içeriği, katkı maddeleri dolayısıyla sürekli ve çok miktarda önermiyoruz ama bazen kampta sucuk ekmek neden olmasın? Yalnız ekmekler, tam buğday!🥖 . Daha fazla öneri için diyetisyengamzealtinay ‘ı takip etmeyi unutmayın. . . . diyet onlinediyet online onlinediyetisyen diyetisyen sucuk sucukluyumurta sucukekmek sucuklu sağlık sağlıklıbeslenme saglik tabak tarif muhtesemtarifler tarifler karbonhidrat şeker diyetisyengamzealtınay tambuğday ekmek yedigller yedigllermilliparkı bolu gl sonbahar yedigoller


0💬Normal

sevenleri görelim🥰 ✔BAYANLARA EVDE EK İŞ✔ GÜNDE 20-50-100 -200 LİRA KAZANACAĞINIZ BİR İŞ TEKLİFİM VAR SİZE. 😊 BEN DE YAPAMAM DİYORDUM 😍 AMA ŞUAN AYLIK BIR GELIRIM VAR. 🌼 SİZDE YAPABİLİRSİNİZ. 🍀💐 DETAYLI BİLGİ İÇİN LÜTFEN MESAJ ATINIZ 😘 BONCUK YADA PAKETLEME DEĞİLDİR👍 Detaylı bilgi için yorum yapın dönüş yapıyorum 💕‼ 👩🏼‍🏫 KENDİ UYELİĞİNİZİ YAPMAK İÇİN PROFİLİMDEKİ LİNKTEN ÜCRETSİZ KAYIT OLABİLİRSİNİZ referans nosunu SİLMEDEN 🧚‍♀🧚‍♀🧚‍♀🧚‍♀🧚‍♀🧚‍♀🧚‍♀🧚‍♀🧚‍♀🧚‍♀🧚‍♀ pasta food tatlı lezzet mutfak tatlıtarifleri tarifler nefisyemektarifleri ke evyemekleri nemlidir istanbul kurabiye yemekrium yemektarifi ankara yemekler pratiktarifler kek yemekteyiz


1💬Normal

● AŞAĞIDAKİ LİSTEYİ TAKIBE AL 24 SAAT İÇERİSİNDE DÖNÜS YAPILACAK. YORUM KISMINA 4 KELIMELIK İSTEDİĞİN KADAR YORUM YAP. ● REKLAM SERBEST ● DUYURU SERBEST ● SAYFA TANITIMI SERBEST ● ÜRÜN TANITIMI SERBEST AŞAĞIDAKİ LİSTEYİ TAKİBE ALIN HEMEN GERİ DÖNÜŞ YAPALIM . . leke.sil_42 kesfetteyim.42 kesfetruzgari tanitimofficial avongulay butik_iremim_elifim morpembe_design sihirlicadde seydisehirlii lea_marketing mia_butiks leapirlantalarekibi nur_butigimm asuman_arslan_design beyazatolyee perabutikbujiteri umayboyali bildircin_organika baskiafis silva_sevda bilkaytasarim nergizcoskun812 rmzyegcgn havva.kahraman85_iletisim_dm butikbellissima herbal_dinamik_yasam_kocu yasam.kocu.kubra idealkilokontrol avukatannee tnzlarsln haticeturkgiyim farmasial ayakkabicileke butik.lekesil silva_cicegim silvaduru silva_moor seydibutik leydiperii blogcunirvana kesfet_delisi. . . . sunum yemektarifleri sunumnemlidir sunumaski mukemmellezzetler sahanelezzetler lezzetlerim hamurişi tarifler kurabiye kurabiyetarifleri enlezzetlitarifler nefisyemektarifleri mucizetatlar lezzetli_tariflerle sizinsunumlar lezzetkareleri sunumduragi sunumsever sunumnerileri keşfet kesfet keşfetteyim kesfetteyim keşfetteyiz kesfetteyiz


10💬Normal

Evde kalan arkadaşlar vazgeçmeyin😊Her gün gülümsemek için lütfen takip ediniz 🤗👉ogretmen_mizah————————————————————————🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷 . . . . . . . . tbt yemek food recipe salatatarifleri çorbatarifleri cahidesultan mükemmellezzetler etyemekleri sütlümutfak nefisyemektarifleri pratikbilgiler yemekpişti sunum sunumnemlidir ankara eskişehir istanbul izmir mutfak pasta yemektarifleri yemektarifi tarif tarifler kolaytarifler pratikyemekler pratiktarifler lezzet gurme


22💬Normal

🥰🥰🥰🥰 Klasik kıymalı cevizli börek🤗 zeynkurabiye - Malzemeler ☘️4 adet yufka ☘️400gr kıyma ☘️3 adet soğan ☘️1 çay bardağı sıvı yağ ☘️kara biber ☘️pul biber ☘️tuz ☘️1 su bardağı ceviz içi - 🌸Yufkaları ıslatmak için Süt ve sıvı yağ karışımı... - Yapılışı👇🏻 ☘️öncelikle tavaya sıvı yağı döküp doğradığımız soğanları ekliyoruz. ☘️orta ateşte pembeleşinceye kadar kavuruyoruz. ☘️kıymayı ekleyip suyunu çekene kadar karıştırmaya devam ediyoruz. ☘️istediğiniz ölçüye göre baharatları ekleyip bir iki kere daha karıştırıp Ocağı kapatıyoruz. 1su bardağı biraz irice çekilmiş cevizi ekliyoruz. - 🌸Her bir yufkayı 6 ya bölelim. 🌸üçgen yufkayı önümüze alıp süt ve sıvı yağ karışımından fırça ile sürelim. 🌸kıymalı harçtan koyup istediğimiz şekli verip üzerlerine yumurta sarısı sürelim. 🌸önceden ısıtılmış 200c fırında pişirelim. Afiyet olsun☺️ tatli tatlı mutfak yemek iftar videolutarif video kesfet yemek tarif tarifler pratiktarifler kolaytarifler sunum sunumnemlidir lezzetlisunumlar tatlı tatli tatlıtarifleri pasta kek çikolata kurabiye çikolatalı nefisyemektarifleri poğaça pogaca hamurisi brek borek afiyetolsun


0💬Normal

🥰🥰🥰🥰 Klasik kıymalı cevizli börek🤗 zeynkurabiye - Malzemeler ☘️4 adet yufka ☘️400gr kıyma ☘️3 adet soğan ☘️1 çay bardağı sıvı yağ ☘️kara biber ☘️pul biber ☘️tuz ☘️1 su bardağı ceviz içi - 🌸Yufkaları ıslatmak için Süt ve sıvı yağ karışımı... - Yapılışı👇🏻 ☘️öncelikle tavaya sıvı yağı döküp doğradığımız soğanları ekliyoruz. ☘️orta ateşte pembeleşinceye kadar kavuruyoruz. ☘️kıymayı ekleyip suyunu çekene kadar karıştırmaya devam ediyoruz. ☘️istediğiniz ölçüye göre baharatları ekleyip bir iki kere daha karıştırıp Ocağı kapatıyoruz. 1su bardağı biraz irice çekilmiş cevizi ekliyoruz. - 🌸Her bir yufkayı 6 ya bölelim. 🌸üçgen yufkayı önümüze alıp süt ve sıvı yağ karışımından fırça ile sürelim. 🌸kıymalı harçtan koyup istediğimiz şekli verip üzerlerine yumurta sarısı sürelim. 🌸önceden ısıtılmış 200c fırında pişirelim. Afiyet olsun☺️ tatli tatlı mutfak yemek iftar videolutarif video kesfet yemek tarif tarifler pratiktarifler kolaytarifler sunum sunumnemlidir lezzetlisunumlar tatlı tatli tatlıtarifleri pasta kek çikolata kurabiye çikolatalı nefisyemektarifleri poğaça pogaca hamurisi brek borek afiyetolsun


2💬Normal

Klasik kıymalı cevizli börek🤗 zeynkurabiye - Malzemeler ☘️4 adet yufka ☘️400gr kıyma ☘️3 adet soğan ☘️1 çay bardağı sıvı yağ ☘️kara biber ☘️pul biber ☘️tuz ☘️1 su bardağı ceviz içi - 🌸Yufkaları ıslatmak için Süt ve sıvı yağ karışımı... - Yapılışı👇🏻 ☘️öncelikle tavaya sıvı yağı döküp doğradığımız soğanları ekliyoruz. ☘️orta ateşte pembeleşinceye kadar kavuruyoruz. ☘️kıymayı ekleyip suyunu çekene kadar karıştırmaya devam ediyoruz. ☘️istediğiniz ölçüye göre baharatları ekleyip bir iki kere daha karıştırıp Ocağı kapatıyoruz. 1su bardağı biraz irice çekilmiş cevizi ekliyoruz. - 🌸Her bir yufkayı 6 ya bölelim. 🌸üçgen yufkayı önümüze alıp süt ve sıvı yağ karışımından fırça ile sürelim. 🌸kıymalı harçtan koyup istediğimiz şekli verip üzerlerine yumurta sarısı sürelim. 🌸önceden ısıtılmış 200c fırında pişirelim. Afiyet olsun☺️ tatli tatlı mutfak yemek iftar videolutarif video kesfet yemek tarif tarifler pratiktarifler kolaytarifler sunum sunumnemlidir lezzetlisunumlar tatlı tatli tatlıtarifleri pasta kek çikolata kurabiye çikolatalı nefisyemektarifleri poğaça pogaca hamurisi brek borek afiyetolsun


7💬Normal

Nişan var dediler geldik😄 No filter no makyaj😂dediklerinden Buda anın fotosu olsun☺️ Büyük oglum ve ben🤗 Mutlu pazarlar efenim🙋 . . bertac__ ❤️ . nişan haftasonu followforfollowback keşfet like4like aniyakala ucaksev45 herbal5izmir nüveli122 arzuhemen21 snycocukgiyi


33💬Normal

Via beyhaninmutfagi Hayırlı akşamlar 😍 Yumurta kokusu sevmeyenler için harika bir kek tarifi ile geldim ✌🏻😎 sosu yumurtasız ıslak kek 😋 mutlaka kayıt edin yıllardır yaptığım bir tarif 👍🏻 erişim engeli için de destek olursanız sevinirim 🙏🏻 tarif isteyenler ❤️ bırakabilir mi ☺️ ben de tarifi düzenleyip geliyorum . . 📌Sosu Yumurtasız Islak Kek . Malzemeler ;
4 tane yumurta
1 su bardağı toz şeker
1 su bardağı süt
Yarım su bardağı sıvı yağ
3 yemek kaşığı kakao
2 paket kabartma tozu
1 paket vanilya
2 tepeleme su bardağı un 📌Sosu İçin;
1 su bardağı süt
2 yemek kaşığı kakao
Yarım su bardağı kadar sıvı yağ
Yarım su bardağı kadar toz şeker 📌Yapılışı ;
Yumurta ve şekeri bir kaba alıp köpürene kadar,
mikser yardımı ile çırpın. Sonra süt ve sıvı yağı ekleyip karıştırın. Elek yardımı ile kuru malzemeleri koyup eleğin ve bütün malzemeler birbirine karışana kadar karıştırın. Kek kalıbını az sıvı yağ ile yağlayıp, kek harcını döküp, önceden ısıtılmış 180 C fırında pişirin. Sosu için gerekli bütün malzemeleri bir kaba koyup şeker iyice eriyene kadar çırpma teli ile karıştırın. Pişen kekin ilk sıcaklığı çıktıktan sonra, dilimleyip hazırlamış olduğunuz sosu dökün. Hindistan cevizi, fındık ile süsleyip servis yapın… NOT ; Sos malzemeleri pişmiyor bu kekin özelliği sadece şeker eriyene kadar bir kabın içinde karıştırın… Afiyet şifa olsun ☺️ . tatli tatlı mutfak yemek gurme videolutarif video kesfet yemek tarif tarifler pratiktarifler kolaytarifler sunum sunumnemlidir lezzetlisunumlar tatlı tatli tatlıtarifleri pasta kek çikolata kurabiye çikolatalı recipe poğaça pogaca hamurisi brek borek afiyetolsun


2💬Normal

Detoks Tanışma Setiyle 1 ayda sonuç alabilirsin 🍃 İncelemek istiyorsan ➡️ Fazlalıklardan kurtulmak istiyorsan ➡️ Bilgi ve sipariş için ⬇️ 📞 05416327780 📩 DM&Whatsapp . . . . . . . tarifler mükemmellezzetler yemektariflerim herbalifekullananlar ankara izmir bursa antalya mersin sacmodel


0💬Normal

🥣ERİK PÜRESİ +8AY🥣 Bebeğinize sunabileceğiniz değişik bir lezzet 😇 🥣Malzemeler : . 🥄Dilediğiniz kadar erik . 🥄Bir miktar pekmez . . 👩🏻‍🍳Yapılışı . ✔️Erikleri (sulu ve mor erikler tercih edilmelidir) akan soğuk su altında . ✔️Doğal çizgisinden ikiye kesin. . ✔️Kalın bir tencerenin dibine su koyun. . ✔️Erikleri koyup, suları akana dek hafif ateşte pişirin. . ✔️Tencerenin kapağını açıp, su buharlaşana dek pişirmeyi sürdürün. . ✔️Meyveleri püre makinesinden geçirip, dilediğiniz tatlılığı sağlayana dek pekmez ekleyin. . ⚠️Uyarılar Bebek ve çocuk yiyeceklerinde şeker kullanmamanız gerekiyor. Şeker yerine ne kullanabileceğinizi merak ediyorsanız bio muzdaki gurmebebek linkini tıklayabilirsiniz. .
 gurmebebek erik mevsim meyvesi sağlıklıbeslenme bebekbeslenmesi çocukbeslenmesi organik tarifler


1💬Normal

Renkli kasemle iyi pazarlar ! ⠀⠀⠀⠀⠀⠀⠀⠀⠀ 3 yk yoğurdu önce buğday çimi tozuyla karıştırdım. İçine tabii sonradan çilekli yoğurdumdan kattım.Bu arada buğday çimi gerçekten faydalı ama dürüst olmak gerekirse devamlı yenilecek bir şey değil. Tadını ben beğenmiyorum. Yine de aldık bir kere ya çeşitlendirerek yenilebilir hallere getirmeye çalışıyorum. ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Bunun dışında tabağımda geri kalanlar hem besleyici hem çok lezzetli.🍭 Mango, biraz renk için yaban mersini, ayçekirdeği içi ve 2 adet brezilya fındığı var. Brezilya fındığı selenyum deposu ve buna bağlı olarak da sağlığımız için çok önemli. Ayçekirdeği içi (tuzlanmamış kavrulmamış) ise içerdiği folik asit(DNA sentezi için), fosfor(kemik sağlığı), protein, E vitamini, selenyum (antioksidan), çinko (metabolizma ve bağışıklık sistemi için) gibi önemli vitamin ve mineralleri bulundurur. Bu da dolaylı olarak kadınların üreme sisteminde yararlı olur. Ayçekirdeği kalorili olduğundan porsiyon kontrolü bilinmelidir.🌻 ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Kaynaklar: ⠀⠀⠀⠀⠀⠀⠀⠀⠀ https://www.dr-gumpert.de/html/proteinhaltige_lebensmittel.html ⠀⠀⠀⠀⠀⠀⠀⠀⠀ https://www.emerald.com/insight/content/doi/10.1108/00070701211219559/full/html ⠀⠀⠀⠀⠀⠀⠀⠀⠀ https://www.sciencedirect.com/science/article/pii/B9780123756886101306 ⠀⠀⠀⠀⠀⠀⠀⠀⠀ https://time.com/5416869/are-sunflower-seeds-healthy/


3💬Normal

Via zeynepinlezzetleri Bu akşamın menüsü 😍 En sevilen ve en kolay yemeklerden izmir köfte 👌Ben yaparken çok keyif aldım 😍 Kızartmadan yapanlarda var ama kızarınca çok daha güzel oluyor 😋 En azından ben öyle seviyorum 🙈 Çok daha lezzetli buluyorum ☺️ Sizlerede belki fikir olur ve yarın için sizlerde iftara yaparsınız 😃 ~~~ İzmir Köfte ~~~ Yarım kilo kıyma 5-6 dilim bayat ekmek 1 yumurta 1 tabe kuru soğan 1 diş sarımsak Kimyon, karabiber, tuz Patates Kızartmak için zeytinyağ Sosu için 1 yemek kaşıpı salça Salçayı açmak için su Kekik Üzeri için Domates ve biber Kıymayı bir kaba alıp üzerine soğan ve sarımsağı rendeliyoruz.. Bayat ekmeği suya batırıp suyunu sıkıyoruz.. Kıymanın üzerine ilave edip baharat ve tuzunuda atıp yoğuruyoruz.. Şekil verip buzdolabına kaldırıyoruz.. Bizde bu arada patatesleri tuzlayıp kızartıyoruz.. Kişi sayısına göre istediğiniz kadar patates kızartabilirsiniz.. Patatesler kızarınca tavaya birazcık zeytinyağı koyup köfteleri kızartıyoruz.. Tepsiye patates ve köfteleri diziyoruz.. Köfteleri kızarttığımız tavaya salçayı koyup suyla açıyoruz içine çok az tuz ve kekik ilave edip tepsimize döküyoruz.. Ve fırında pişiriyoruz.. Afiyet olsun ♥️ . . . . . tatli tatlı mutfak yemek iftar videolutarif video kesfet yemek tarif tarifler pratiktarifler kolaytarifler sunum sunumnemlidir lezzetlisunumlar tatlı tatli tatlıtarifleri pasta kek çikolata kurabiye çikolatalı nefisyemektarifleri poğaça pogaca hamurisi brek borek afiyetolsun


3💬Normal

● AŞAĞIDAKİ LİSTEYİ TAKIBE AL 24 SAAT İÇERİSİNDE DÖNÜS YAPILACAK. YORUM KISMINA 4 KELIMELIK İSTEDİĞİN KADAR YORUM YAP. ● REKLAM SERBEST ● DUYURU SERBEST ● SAYFA TANITIMI SERBEST ● ÜRÜN TANITIMI SERBEST AŞAĞIDAKİ LİSTEYİ TAKİBE ALIN HEMEN GERİ DÖNÜŞ YAPALIM . . leke.sil_42 kesfetteyim.42 kesfetruzgari tanitimofficial avongulay butik_iremim_elifim morpembe_design sihirlicadde seydisehirlii lea_marketing mia_butiks leapirlantalarekibi nur_butigimm asuman_arslan_design beyazatolyee perabutikbujiteri umayboyali bildircin_organika baskiafis silva_sevda bilkaytasarim nergizcoskun812 rmzyegcgn havva.kahraman85_iletisim_dm butikbellissima herbal_dinamik_yasam_kocu yasam.kocu.kubra idealkilokontrol avukatannee tnzlarsln haticeturkgiyim farmasial ayakkabicileke butik.lekesil silva_cicegim silvaduru silva_moor seydibutik leydiperii blogcunirvana kesfet_delisi. . . . sunum yemektarifleri sunumnemlidir sunumaski mukemmellezzetler sahanelezzetler lezzetlerim hamurişi tarifler kurabiye kurabiyetarifleri enlezzetlitarifler nefisyemektarifleri mucizetatlar lezzetli_tariflerle sizinsunumlar lezzetkareleri sunumduragi sunumsever sunumnerileri keşfet kesfet keşfetteyim kesfetteyim keşfetteyiz kesfetteyiz


429💬Normal

lezzeti_ask ・・・ Kurabiye sevenler yoruma kalp bırakabilir mi ❤️❤️ Çok kisa surede hazirlayabileceginiz dilim kurabiyeler 🍫 Dilim kurabiye 200 gr oda sıcaklığında tereyağı 1 çay bardağı sıvı yağ Yarım çay bardağı toz şeker 1 dolu yemek kasığı yoğurt 1 yumurta 1 paket vanilya 4-4.5 su bardağı kadar un Butun malzemeleri karistirip kurabiye hamuru yumusakliginda yoguralim ve hamuru 4 e bolup firin tepsisine uzun olarak dizelim.videodaki gibi sekil verip 175 derecede pisirelim.soguduktan sonra pudra sekeri serpelim.. Iri cekilmis findik ve uzerine kahvaltilik cikolata sıkalim..kahvaltilik cikolata( nutella, nuga, torku, sarelle vs..) En son kucuk kucuk keselim.Afiyet olsun . . . . tatli tatlı mutfak yemek gurme videolutarif video kesfet yemek tarif tarifler pratiktarifler kolaytarifler sunum sunumnemlidir lezzetlisunumlar tatlı tatli tatlıtarifleri pasta kek çikolata kurabiye çikolatalı recipe poğaça pogaca hamurisi brek borek afiyetolsun


6💬Normal

Merhaba arkadaşlar Kısa bir süre önce tarifini paylaştığım geleneksel bayram kömbemizin detaylı yapılışı... Yoğurtlu kömbe ya da yaş kömbe de deniliyor.... Genellikle bayramlarlarda misafirler için ikramlık olarak hazırlanır. Vereceğim tarif yaklaşık 5 kg un için, toplamda 16 adet kömbe çıktı. Siz ne kadar yapmak istiyorsanız malzemeleri ona göre ayarlayın... Kaydetmeyi unutmayın ☺️☺️ BAYRAM KÖMBESİ, YAŞ KÖMBE, YOĞURTLU KÖMBE 👉👉👉Malzemeler : 👉👉Hamuru için 5 kg kadar un 2, 5 pk kabartma tozu Yarım paket karbonat 1,5 küçük paket kurumaya 1 yemek kaşığı öğütülmüş rezene Yarım tatlı kaşığı öğütülmüş çörek otu 4 pk vanilya 2 kg kadar süt 1,5 su bardağı zeytinyağı 1,5 su bardağı yoğurt 3 su bardağı kadar şeker 👉Kuru malzemeler yoğurma kabına alınır. Sıvı malzemeler ayrı bir kapta harmanlanır, yavaş yavaş una eklenerek sert bir hamur yoğurulur. Hamur üzeri kapatılarak 2 saat kadar dinlendirilir. 👉👉Yoğurtlu Harcı İçin: 2,5 kg kadar yoğurt 400 gr kadar tahin Yarım tatlı kaşığı öğütülmüş çörek otu 2 tatlı kaşığı öğütülmüş rezene 3 yemek kaşığı susam Şeker (Damak tadınıza göre) 👉Bütün malzemeler homojen olacak şekilde harmanlanır. 👇👇👇👇👇 Dinlenen hamurdan iri portakal büyüklüğünde bezeler yapılır. Oklava ile pasta tabağı büyüklüğünde açılır. kenarları elle sıkıştırarak hafif yükseltilir. İç harcını daha iyi alması için kömbe aparatıyla( ceviz ağacından el yapımı bu aparata cıncık deniliyor burda) izler yapılır. Pişirme tepsisine alınır. Ortasına iki kepçe yoğurtlu harç dökülerek yayılır. Fırında altı kızarana kadar pişirilir. Pişen kömbeler oda sıcaklığına gelince, servis kolaylığı açısındaniç yüzleri karşılıklı gelecek şekilde üst üste konulur. Üçgen şekilde dilimlenerek servis yapılır. Afiyet olsun ☺️☺️ hamiyetintarifkutusu humaysem tarifler yemek yemektarifi pasta brek çrek kurabiye tatlı kahvaltılık kek truff hayatburada repost tarifimcahideye mükemmellezzetler nefisyemektarifleri kmbe yaşkmbebayramkmbesi#


6💬Normal

😊Her gün gülümsemek için lütfen takip ediniz 🤗👉ogretmen_mizah————————————————————————🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷 . . . . . . . . tbt yemek food recipe salatatarifleri çorbatarifleri cahidesultan mükemmellezzetler etyemekleri sütlümutfak nefisyemektarifleri pratikbilgiler yemekpişti sunum sunumnemlidir ankara eskişehir istanbul izmir mutfak pasta yemektarifleri yemektarifi tarif tarifler kolaytarifler pratikyemekler pratiktarifler lezzet gurme


25💬Normal

Patatesten vazgecemeyenler icin🙈☺️ Mutlaka kaydedin, begenmeyi de unutmayin😎 Buraya yaziyorum ama sizden mini mini bir emoji alirimm💓✔️ Patates severim diyorsaniz bunu mutlaka deneyin diyorumm😎 Evdeki malzemelerle bes dakikada hazirlayabilirsiniz💜 Hazirladiktan sonra pisirmeden dondurabilir ve o sekilde saklayabilirsiniz. En önemli nokta haşlanmış patatesleri mutlaka buzdolabinda sogutun. patateskroket Malzemeler: 🌺3 patates 🌺1 yemek kaşığı nişasta 🌺1yumurta 🌺1 tatlı kaşığı tuz 🌺küp doğranmış kaşar 🌺ayrıca panelemek icin galeta unu, yumurta ve un🌺kızartmak için sıvıyağ 🌺patatesleri haşlayıp rendiyoruz, nişasta, tuz ve yumurtayı ekleyip arasina bir küp kaşar koyup şekil veriyoruz.sırasıyla un, çırpılmış yumurta ve Galeta ununa buladiktan sonra kızartıyoruz. Ben azıcık karabiber de ekledim. Ayrica sekil verirken ellerinizi her seferinde mutlaka ıslatın!! O zaman yapışmadan kolayca yapılıyor. fazla yumusak olsa bile korkmayın, paneledikten sonra 5-10 dakika dondurucuya atarsanız toparlıyor Yine de elinize yapışırsa biraz daha nişasta ekleyebilirsiniz. Ayrıca una yumurtaya bulamak istemezseniz sadece galeta ununa da bulayarak yapabiliyoruz aklinizda olsun👍🏼Hoşçakalın bu arada dondurucuya atıp daha sonra kızartınca içleri daha yumusak, dışları çıtır oluyor:) tavsiye ederim. afiyetolsun patateskroket kroket patates patateskızartması yemekrium atıştırmalık harikasunumlar sunum sunum_dunyam tarifler kolaytarif keşfet Mutlusabahlar enfes menü geritakipyapıyorum takipçi gününmenüsü kesfetteyiz reklamver nefisyemektarifleri cheflerintarifleri tatli kek kurabiye fırınyemekleri güveçyemekleri


1💬Normal

Yulaflı Poğaça🥯 🥣1 su bardagi yoğurt 🍸1 çay bardağı zeytin yağı 🥚2 yumurta (1 nin sarısı ayrılacak) 🍯1 tatlı kaşığı bal 🍚1cay kaşığı tuz 🍚2,5 su bardağı yulaf unu 🍚3 su bardağı tam buğday unu 🍙Kabartma tozu 🥄1 cay kaşığı mahlep 🥄Çörek otu İç malzeme 🌿Lor ve maydonoz 🥣Öncelikle bir kapta yoğurt, zeytin yağı, yumurta, bal, mahlep ve tuz elimizle karistirilacak. 🍚1 bardak yulaf unu ile kabartma tozu karıştırılarak yavaşça eklenip elimizle karıştırılacak. 🍚Sırası ile tam buğday 1 yulaf 1 şeklinde un yavaş yavaş eklenip yoğrulacak. 🥠Hamurumuzda paracalar koparılarak sadeler için elimizde yuvarlayıp oval, peynirliler için lor ve maydonoz karışımını koyacağız ikiye katlayacağız. 🥚Üzerine kalan yumurta sarısı ve çörek otunu serpip fırına verecegiz 🔥180 derece onceden ısıtılmış fırında üzeri kızarana dek pişireceğiz. Yaklaşık 25-30 dk😌 Afiyet olsun😋 sağlıklıpogaca healthy yulafunu kahvaltı pogaca breakfast caypogaca diyet sagliklibeslenme saglikliyasam lif afiyetolsun sicak gevrek tarifler


1💬Normal

😂Her gün gülümsemek için lütfen takip ediniz 🤗👉ogretmen_mizah————————————————————————🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷 . . . . . . . . tbt yemek food recipe salatatarifleri çorbatarifleri cahidesultan mükemmellezzetler etyemekleri sütlümutfak nefisyemektarifleri pratikbilgiler yemekpişti sunum sunumnemlidir ankara eskişehir istanbul izmir mutfak pasta yemektarifleri yemektarifi tarif tarifler kolaytarifler pratikyemekler pratiktarifler lezzet gurme


27💬Normal

Yağmurlu bi günden selamlar,mutlu pazarlar❤❤ supanglesupangletarifikakaolutatlilarmükemmellezzetlertariflersunumlar#


3💬Normal

Kuşbaşılı Pide Tarifi 😋 Geleneksel lezzetlerimizde bugün kuşbaşılı pide tarifi var! Mekanlarda içeriği belli olmayan pideleri yemektense en lezzetlisini ve sağlıklısını evinizde yapabilirsiniz. ekersuturunleri 😍 Malzemeleri? 1 su b. su 2 çay k. tuz 3 gr. maya 3 su b. un 250 gr. dana kuşbaşı 3 ad. domates, doğranmış 2 ad. çarliston biber, doğranmış 1 ad. kapya biber doğranmış 1 tatlı k. toz biber 1 çay k. karabiber 1 çay k. tuz ½ fincan zeytinyağı Nasıl Yapılır? 1. Hamuru için derin bir kaseye, su, tuz ve maya ilave edip, çırpın. Un ilave edip, karıştırın ve yoğurun. Üzerini streç film ile kapatıp 1 saat oda sıcaklığında bekletin. 2. Derin bir kaseye, dana kuşbaşı, domates, çarliston biber, kapya biber, toz biber, karabiber, tuz ve zeytinyağı ilave edip, karıştırın. 3. Hamuru 6 eşit parçaya bölüp, her bir parçayı zemini unlu masanızda merdane veya oklava yardımıyla açın. 4. Hazırladığınız harçtan kepçe ile alıp, hafif bastırarak hamurun üzerine yayın. 5. Önceden 200 dereceye kadar ısıtılmış fırında 8-10 dk. pişirin. 6. Kara lahanalı salata, sumaklı soğan, maydanoz ve limon ile servis edebilirsiniz. Afiyet olsun.! ⁣ ⁣⁣⁣⁣ ⁣⁣yapye tarifler recipes yemektarifleri food foodie pide kuşbaşılıpide pidetarifleri hamurisi hamurişi


0💬Normal

Mutlu pazarlar sevgili takipcilerim Biraz mütevazı olamiyacagim galiba Maşallah 416 paylaşım tarif ağırlıklı olarak yemek tarifleri paylasmisim çünkü biz Hanımların en büyük derdi ne pisirecem, bol yemek tarifi sayfası ile degisik lezzet arayanlar icin farkli ulkelerden tarifler.buyrun yine kolay herkesin Sevdiği MANTARLI KREMALI MAKARNA Malzemeler.Istediginiz herhangi bir makarna çeşidi 1 kutu krema 2 büyük mantar,2adet sivribiber 1tane büyük domates rendesi,3,4 dal fesleğen, 2 dis sarimsak, 1tatli Kaşığı salca, tuz,yarım çay kaşığı karabiber, Yarım çay kaşığı pulbiber, zeytinyag Yapilisi.Tenceremize suyu koyalim Kaynasin. Makarna suyu için tuzumuzu atıp belirgin olsun tuzu makarna haslansin,tavamiza zeytinyagimizi koyup içine dogradigimiz mantarları atıp biraz Kavrulsun içine sivribiber ve dogradigimiz sarımsaklari katıp söyle bir cevirelim,uzerine rendelenmiş domates ve feslegenimizi katalim tuz ve baharatları ile biraz pissin kremamizi da ekliyelim.haslanan makarnaya içerisine katıp karıştıralım servis tabağına alalım sizde varsa makarnamizin uzerine parmesan dokebilirsiniz çok güzel olur bende kaşar vardı rendesini döktüm uzerine tavsiye ederim yapmanizi leziz oldu.Afiyet olsun.pratiktarifler yummyfood homemade mastechef instafood sahanelezzetler delicious deliciousfood ankara kirsehir istanbul numnum hungry sunumonemli cookbook9tarif makarna kesfetteyim nefisyemektarifleri yemekcomtarifler numnum yemeksofralari onedioyemek food


7💬Normal

Kahvaltım🥣 200 gr vanilyalı quark Tavada 5 dakikada yaptığım çıtır çıtır granola (çıtırlığını duymak sola kaydırın⬅️) Elma Tarçın . . . Daha fazla sağlıklı yemek tarifi için: Takip Et: kitchen2ce Takip Et: kitchen2ce Takip Et: kitchen2ce . . . sağlık diet diyet sagliklibeslenme tarifler sagliklitarifler healthyrecipes healthy sağlıklı tarif şekersiz sağlıklıtarifler sagliklikahvalti breakfast ontbijt healthyfood healthychoices sekersizbeslenme sekersiztarifler healthylifestyle eatclean foodglooby nutrition getfit fitrecipe passionforcooking cooking foodie foodshare


0💬Normal

birgulunlezzetleri Yeni bir güne merhabalar🙋‍♀️ günün her saati yenilebilecek lezzetler vardır ya işte KABAK YOĞURTLAMA onlardan bir tanesi.. Hem Fresh hem de kalsiyum deposu , zeytinyağlı ve sebzeli... Bu sunuma el yapımı tabaklarım eşlik etti.. el emeği, göznuru bu güzel tabaklarla lezzetime büyük katkıları için fusska ya çok teşekkür ediyorum. 💕 5 dakikalık bir tarif aslında şimdi de tam zamanı... körpe kabakları alın ve irice rendeleyin çok sulanırsa hafifçe suyunu sıkın ama asla ezmeyin.. tavaya zeytinyağı koyun şöyle bir çevirin... Sakın fazla yıpratmayın🤗 birkaç kez çevirdikten sonra ocaktan alın hafifçe ılımaya bırakın.. süzme yoğurda çok az tuz koyup karıştırın... bir kahve fincanı kadar da lor ilave edin... en son hazırlanmış kabakları içine koyarak karıştırın sunum tabağınızı alın, üzerine sızmaya pul biber ve dereotu gezdirin. Hepsi bu kadar lezzetlerimiz bol olsun.. lezzet birgulunlezzetleri sağlıklı tarifler peynir yoğurt kesfet meze


3💬Normal

Gitmezzz 🍔


1💬Normal

PROFİLİMDE LİNK MEVCUT 👆🏻👆🏻 EN SAĞLIKLI,EN KOLAY EV YAPIMI 3 MALZEME İLE FISTIK EZMESİ TARİFİ✨✨ Sizler için çektim YouTube kanalıma yükledim,Profilimde Link mevcut izleyebilirsiniz💙☘️ youtube youtuber evyapımı evyapımıfıstıkezmesi ensaglikli tarifler fıstıkezmesi fıstık diyet diyetteyiz sağlıklıseçimler mutfak blogger fıstıklı


2💬Normal

Repost gulun_ellerinden (get_repost) ・・・ gulun_ellerinden 👈👈👈 Allah bir ömür boyu hayırlı insanlarla karşılaştırsın hepimizi... mutlu bir hafta sonu diliyorum. Huzurlu akşamlar canlar 🤲 . Videomu izlediyseniz eğer beğenmeyi❤ ve yoruma bir gül bırakmayı unutmayın canlar🌹😉 . 👇👇👇👇👇👇👇👇👇👇👇👇👇👇👇👇👇👇👇👇👇 Pratik ve lezzetli tarifler listenize bir yenisini daha eklemeye ne dersiniz Parmaklarınızı yiyeceksiniz o kadar lezzetli👌😋 hemen NOT edin derim 👍 . . TAVUK MİDYE ŞİŞ gereken malzeme 3 adet tavuk göğüs eti 1 çay kaşığı karbonat 1 su bardağı su . . Sosu için 1 su bardağı un 1 şişe maden suyu 2 diş sarmısak 1 çay kaşığı toz kırmızı biber 1 çay kaşığı kara biber 1 çay kaşığı kekik 1 tatlı kaşığı tuz . Bulamak için 1 su bardağı un . Kızartmak için sıvıyağ . . YAPILIŞI: tavuk eti küp küp doğranır... bir su bardağı su ile bir çay kaşığı karbonat karıştırılır... tavuk eti karışıma ilave edilir... 30 dk bekletilir... Sosu hazırlanır un baharat ve tuz 2 dış sarmısak rendesi maden suyu ilave edilerek çırpılır... hafif aralık bırakılarak şeşe dizilen tavuk etleri once una daha sonra maden sodalı sosa bulanarak orta ateşte ısıtılmış yağda alt üst nar gibi kızarana kadar pişirilir.... sevdiğiniz soslar ile servis yapabilirsiniz afiyet olsun...😋👌👍 . . . . . . . . .. lezzet sunumlezzetli yemek food recipe recipessalatatarifleriçorbatarifleri cahidesultanmukemmellezzetleretyemekleri sütlümutfak nefisyemektarifleri pratikbilgiler sunumonemlidir tarif tarifler yemektarifleri sahanelezzetler pasta istanbul ankara lezzetelçisi kurabiye lezzetrium delicous tuzlukurabiye


0💬Normal

Bende şuan uykudan yazıyorum Herkese günaydın 😂😂😂Her gün gülümsemek için lütfen takip ediniz 🤗👉ogretmen_mizah————————————————————————🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷🇹🇷 . . . . . . . . tbt yemek food recipe salatatarifleri çorbatarifleri cahidesultan mükemmellezzetler etyemekleri sütlümutfak nefisyemektarifleri pratikbilgiler yemekpişti sunum sunumnemlidir ankara eskişehir istanbul izmir mutfak pasta yemektarifleri yemektarifi tarif tarifler kolaytarifler pratikyemekler pratiktarifler lezzet gurme


22💬Normal

Evde kendinizin hazırlayacağı çıtır simit🤤 PEKMEZLİ SİMİT 1 SB ılık su 1 SB ılık süt 1 SB sıvıyağ 1 YK şeker 1 TK tuz 1 paket yaş maya 2 YK Vita yağ(yoksa tereyağ da kullanabilirsiniz) Aldığı kadar un Pekmezli sos için; 1 ÇB üzüm pekmezi Yarım ÇB su 1 SB susam(kavrulmuş) Hamuru için bütün malzemeleri karıştırıp yoğurun ve üzerini streçlenip yarım saat dinlendirin. Hamurdan bezeler alıp uzun şekilde elle hamuru açın ve yuvarlak şekilde birleştirin. Pekmezli sosu için üzüm pekmezini su ile sulandırın hamuru önce sosa daha sonra kavrulmuş susama batırıp yağlı kağıt serili fırın tepsisine koyup fırında kızarana kadar pişirin. . . Takip etmeyi unutmayın lütfen👉 the_pastryy . . . . . . . . . . . yemektarifleri yemek yemekteyiz eating fitanne diyet kiloverme zayıflama diyetteyim diyettarifler tatlı tarifimcahidiye tarifler tarif tarifdefteri tarifizor insta instagram tarif eatclean sağlıklıyaşam sağlıklıyemekler blogger kilovermekistiyorum diyetteyim fsağlıklıyemekler sağlıklabeslenme healthy


0💬Normal

YouTube için çok keyifli bir video serisi hazırladık. Dünya lezzetlerini pratik tariflerle mutfağınıza getiriyoruz! İlk video 21 Ağustos Çarşamba YouTube kanalımda. Abone olmadıysanız vaktiniz var link profilde..ilgisini çekecek arkadaşlarınızı bu gönderiye etiketliyebilirsin. Destekleri için özel teşekkür ertnylmzzz gezipgelicez erolmutfakta pizza napoletanapizzapizza instafoodpic instafoodvideo lezzettarifler tatlı dolce çilekpratiktarifler dünyalezzetleri videotarif tarifleryoutube istanbul homemade evyapımı evdeyap sendeyapabilirsin


4💬Normal

Credit to from gencanneninblogu (get_regrann) - Tam bir Şifa deposu çorba hasta bebekler için de birebir♥️ Hem de çok pratik 👍🏻 Tavuk suyu çorbası🥣 Malzemeler; 4 küp tavuk suyu Yarım su bardağı sıcak su 1 tepeleme yemek kaşığı tel şehriye 1 yemek kaşığı didilmiş tavuk eti 1 silme tatlı k. Un Birkaç damla limon Zeytinyağ Yapılışı;🥣 Tencereye yağı ve unu alıp unu kavuruyoruz. Üzerine sıcak suyu ardından tavuk küplerini ekliyoruz. Kaynayınca içerisine şehriye ve tavukları ekliyoruz. Şehriyeler piştikten sonra servise hazır. Servis etmeden önce limon sıkalım 😋 Afiyet şifa olsun inşallah♥️ (Tavuk suyunun yapımı bir kaç post önce var göz atabilirsiniz🌸) . . . . . canımoğlum bebeğim ekgıda ekgıdayageçiş ekgida ekgıdatarifleri ekgıdanerileri ekgida kahvaltılık kahvaltilik muzlukahvaltı hamileanne hamileanneleremzirenanneler internetanneleri keşfetteyiz bebektarifleri tarifler bebekkahvaltısı keşfet keşfetteyiz keşfetteyizz instagood instalove takip takipçi instagram tavuksuyunaçorba tavuksuyuçorba


1💬Normal

Yaz bitiyor👯 Deniz, kum, güneş derken saçlar iyice yıprandı. Vitamin- mineral eksikliği saç kaybına neden olmaktadır. Beslenmeyle saçlara ne kadar destek olabiliriz dersek; 📌Çinko desteği yapmalısınız. Çinko içeren besinler arasında; Karides, istiridye, balık, et, karaciğer, buğday tohumu, kabak çekirdeği, ayçiçeği çekirdeği, tüm tahıllar, ceviz, badem, yumurta, peynir ve süt C vitamininden zengin beslenmek, saçların daha hızlı uzamasına fayda sağlar.🌾 Avakado, saç uzamasına destek olan E vitaminini barındırır.🥑 Yumurta, saç uzaması ve güçlenmesi için protein ve biotin kaynağıdır.🥚 • saç saçbakımı saçbakımyağı healthyfood healthyspagetti healthyfoodinspor beslenmevediyet beslenmegünlüğü beslenmedefteri beslenmevediyetetik beslenmenerileri besin saglikligida sağlık sagliklivücut sagliklivücut saglikliyasam yaşam beslenme tarifler tarif


0💬Normal

Öğle yemeği için bir önerimiz var! Keşkek yemeye ne dersiniz? 😊 Nedir keşkek? Nereden gelmiş, nasıl oluşmuş, besin değeri nedir? Merak uyandırdıysa sizi gönderimize alalım. :) Yüsra Güneş tarafından yazılan keşkek hakkında detaylı bilgi için; https://gastronomicsecrets.com/keskek/ gastronomicsecrets gastronomi gastronomy keskek keşkek tarihindentarifine tarifler tarif tarih hellise herse Bayburt bayburt ağrı


0💬Normal

Sen nasıl güzel Bi annesin. Maşallah sedabakanerel ve bebişin hayırlı saglıklı güzel ömürler diliyoruz. Hanimlar evde vaktinizi bos gecirmek istemezseniz benim gibi degerlendirebilirsiniz. Yaptigim is evden ic camasirı kozmetik kişisel bakım temizlik ÜRÜNLERİ. Dış giyim satmak. El isiyle gunlerce yapip 50_60tl kazaniyorsunuz. Bundan bir sipariste 60 70 tl sicak para kazaniyorsunuz. Magazaya gitme geregi bile duymadan ihtiyaçlarinizi aliyorsunuz.kapiniza kadar kargonuz getiriyor. Ucretsizdir üyeliğimiz. Istemediginiz anda birakabilirsiniz. Bilgi almak isteyenler yoruma nokta koymanız yeterlidir📍📍📍 TUGBA BİNAY pasta food tatlı lezzet mutfak tatlıtarifleri tarifler nefisyemektarifleri ke evyemekleri nemlidir istanbul kurabiye yemekrium yemektarifi ankara yemekler pratiktarifler kek yemekteyiz


0💬Normal

Herkese Merhaba ☀️😃 💜 Günaydın canlarım 💜💜💜 Sizlere çok güzel bir poğaça tarifim var kesinlikle denemelisiniz 🌸 Hem çok yumşak pamuk gibi hem de çok lezzetli ⭐️ . . . MAYALI POĞAÇA 2 yumurta akı (sarısı üzerine) Yarım paket yaş maya 1 çay bardağı ılık su 1 çay bardağı sıvıyağ 1 çay bardağı süt 2 yemek kaşığı yoğurt 3 tatlı kaşığı şeker 1 tatlı kaşığı tuz 75 gram yumuşak margarin 9/10 çay bardağı un YAPILIŞI İlk önce poğaça hamurumuzun ön mayasını hazırlayalım.Uygun bir kaba ılık su şeker ve yaş mayayı koyup hepsini çırpma teliyle pürüzsüz olacak şeklide çırpalım.Unumuzdan 2 yemek kaşığı ekleyip tekrar pürüzsüz olacak şekilde çırpalım.Ve 10 dk mayalandırmaya bırakalım.Mayamız oluncaya kadar sıvıyağ ve sütü ocakta hafif ısıtalım.Sıcak olmasın❗️ sonra poğaçamızı yoğurmaya başlayalım.Yumurta akı tuz yoğurt ısıttığımız sıvıyağı ve sütü alıp çırpma telimizle pürüzsüz olana kadar çırpalım.Yavaş yavaş unumuzu ekleyerek hamurumuzu yoğurmaya başlayalım.Biraz ele yapışan yumuşak bir hamur olduktan sonra margarini koyup yoğuralım.Margarini yedirdikçe elimize yapışmayacaktır ve yumuşak bir hamur olacaktır.Hamurumuzu ele yapışmayacak şekile gelene kadar yoğuralım.Sonra mayalanmaya bırakalım.Ben 1 saat mayalandırdım 40-45 dk da yeterli olacaktır.Hamurumuzun mayası gelince ben yuvarlak şekil verdim içlerine peynir koydum.Poğaçaları tepsiye dizdikten sonra 15-20 dk tepsi mayası yaptım.Üzerine yumurta sarısı sürdüm çörek otu serptim.Önceden ısıtılmış 200 derece fırında pişirdim.Şimdiden afiyet olsun ❤️❤️❤️❤️❤️❤️❤️❤️❤️❤️ sunum nefissunumlar sunumnemlidir muhtesemsunumlar sunumtabağı sunum_dunyam tarif muhtesemtarifler tarifler sunumvetarif poğaça mayalıpoğaça poğaçatarifi yumuşakpoğaça harikapoğaça peynirlipoğaça beşçayıtarifleri beşçayımenüsü kesfet yemektarifleri hamurişi hamurişitarifleri


0💬Normal

Nutellayı anımsatan sağlıklı bir lezzet şölenine merhaba diyelim😍 Nutella tadında sadece 3 malzemeli, kuruyemiş içermeyen rafine şekersiz hurmanella yaptım😋 Sabah kahvaltılarında ekmeğin üzerine, tatlı krizlerinde 1 kaşık, muzun veya meyvelerin üzerine ve kek/kurabiyelerinizde şekere alternatif olarak kullanabilirsiniz😍 . Malzemeler: 5 adet hurma 1 dolu tatlı kaşığı kakao 1 yemek kaşığı hindistan cevizi yağı Sıcak su revnacakir 'ın elinden ❤ . . . . . . . . . . . . . . . . yemektarifleri yemek yemekteyiz eating fitanne diyet kiloverme zayıflama diyetteyim diyettarifler tatlı tarifimcahidiye tarifler tarif tarifdefteri tarifizor insta instagram tarif eatclean sağlıklıyaşam sağlıklıyemekler blogger kilovermekistiyorum diyetteyim sağlıklıyemekler sağlıklabeslenme healthy


10💬Normal

Bu tarif o kadar kolay ve öyle nefis oluyor ki bir tepsiyi tek başınıza yiyebilirsiniz 🙈 Bayat ekmeklerle sadece 5 dakikada hazırlayabilirsiniz 🙋🏻‍♀️ ❤️ Videomu izlediyseniz eğer beğenmeden geçmeyin... destek için yoruma da nokta dahi olsa bırakırsanız çok mutlu olurum😉🙈🙏 Malzemeler; 1 miktar dilimlenmiş bayat ekmek 1 adet yumurta 3 yemek kaşığı yoğurt 3 yemek kaşığı tereyağı bir kase kaşar peyniri rendesi 1 kase ince dilimlenmiş domates Hazırlanışı; Via umutsepetim Yumurtamızın üzerine tuz ekleyip güzelce çırpalım Yoğurdumuzu ve erittiğimiz tereyağı mızı da ekleyip tekrar çırpalım Ekmeklerimizi tepsiye dizip üzerlerine hazırlamış olduğumuz sostan kaşık yardımıyla sürelim. Daha sonra ekmeklerin üzerine kaşar peynir rendesi yerleştirelim. Son olarak kaşarlarımızın üzerine domates dilimleri yerleştirip önce ısıttığımız 180 derece fırında üzeri kızarana kadar pişirelim Afiyet şifa olur inşallah ☺️ . 👉SİZDEN RİCAM NOKTA DAHİ OLSA YORUM YAPMADAN GEÇMEYİN LÜTFEN🙏❤️ . . . . . . . . . tbt yemek food recipe salatatarifleri çorbatarifleri cahidesultan mükemmellezzetler etyemekleri sütlümutfak nefisyemektarifleri pratikbilgiler yemekpişti sunum sunumnemlidir ankara eskişehir istanbul izmir mutfak pasta yemektarifleri yemektarifi tarif tarifler kolaytarifler pratikyemekler pratiktarifler lezzet gurme


34💬Normal

KAHVALTI🥦🌰🥪🥚☕🥒🌶 🍑🍓🍯🍯🍞🧀🍳🍳🍳🌭🌭🍅🍅🍅🍅🍅🍅🍈🍈🍈🍈🍍🍍🍈🍍🍈🍍🍈🍈🍍🍈🍍 🍊🍊🍊🍓🍓🍇🍇🍎🍎🍐🍐🍏🍏🍍🍍🍯🍯 kahvaltılıktarifler yumny morning kahvaltım yemektarifleri yoğurt meyve tarifler diyet diyetyemekleri diyetlistesi diyetteyim diyettarifler diyetkolik diyetnerileri diyetgünlüğü fit kalorihesabi kalorihesaplama kaloriyakma kalori saglıklıbeslenme saglıklıyasam yağyakmak protein


0💬Normal

hamurger 5_cayi_tariflerii Su bardağı ölçüm 200 ml Mayalı hamurları her zaman için iyice özleşene kadar yoğurmalısınız. 40 dk mayalandıktan sonra hafif yoğurup gazını çıkarmalısınız maya kokmaması için önemli bir nokta. 10 15 Ddk tepsi mayası için bekletirseniz iç kısmı yumuşacık delik delik oluyor. HAŞHAŞLI ÇÖREK İÇİN MALZEME LİSTESİ: 500 gr ılık su ve süt karışımı (2 buçuk su bardağı) Yarım çay bardağı sıvıyağ 1 tatlı kaşığı tuz 1 tatlı kaşığı şeker 1 paket kurumaya Araları için 1 kase haşhaş 1 çay bardağı sıvıyağ poğaça pogaca ankara mutfak pasta kek tatlı tatli tatlıtarifleri çikolata kurabiye tatlitarifci tatlitarifci kektarifi kektarifleri çikolatalı yemek yemektarifleri yemektarifi tarif tarifler sunum istanbul sunumlar kolaytarifler pratikyemekler pratiktarifler lezzet nefisyemektarifleri brek


2💬Normal

kcelebi_tarifleri Arnavut cigeri ... Cigerleri iyice yikayip suzdurun ..ince ince dograyin ...cigerleri un , tuz ,karabiber ve pulbiber karisimina bulayin sonrada suzgece alin fazla ununu cirpin ...bol kizgin yagda kizartin ..(cok kizartmayin kurumasin 6-7 dakika yeterli oluyor ).... yanina patates kizartmasi ,biber kizartmasi ve sogan salatasiyla servis yapabilirsiniz ... . . tatli tatlı mutfak yemek gurme videolutarif video kesfet yemek tarif tarifler pratiktarifler kolaytarifler sunum sunumnemlidir lezzetlisunumlar tatlı tatli tatlıtarifleri pasta kek çikolata kurabiye çikolatalı recipe poğaça pogaca hamurisi brek borek afiyetolsun


1💬Normal

Merhabalar ❤PATATESLİ TUZLU KEK . görüntü kek ama poğaça börek arası lezzeti ile tarif defterinizde yerini alacak bir tarif 👌 hayatmutfagm • • • • • • Malzemeler 3 adet yumurta Yarım su bardağı sıvı yağ 1 su bardağı yoğurt 1 su bardağı süt 1 tatlı kaşığı tuz 2 adet patates 1 küçük kase küp peyniri 1 tutam maydanoz 1 tutam dereotu 1 çay kaşığı pulbiber 2.5 su bardağı un 1.5 paket kabartma tozu YAPILIŞI. Önce patatesleri soyup küçük küp küp doğruyoruz ardından çırpma kabına 3 yumurta koyup çırpıyoruz süt yoğurt ve sıvı yağı koyup tekrar çırpıyoruz kabartma tozu ve tuzunu atıp çırpıp çiğ patateslere biraz un serpip unluyoruz (bu dibe çökmesine mani oluyor )ve malzemeyle buluşturuyoruz ardından peynir ve doğranmış dereotu maydozla beraber koyup karıştırıyoruz Yağlanmış kek kalıba döküp 180 derece fırında üzeri kızarana kadar pişiriyoruz afiyet bal olsun 😋😋 tatli tatlı mutfak yemek gurme videolutarif video kesfet yemek tarif tarifler pratiktarifler kolaytarifler sunum sunumnemlidir lezzetlisunumlar tatlı tatli tatlıtarifleri pasta kek çikolata kurabiye çikolatalı recipe poğaça pogaca hamurisi brek borek afiyetolsun


1💬Normal

💓KADAYIFLI PAŞA SARMASI💓TARİFİ 300 gram Kadayıf2 dolu yemek kaşığı Tereyağı 💎Muhallebisi için 1 litre Süt4 yemek kaşığı Un7 yemek kaşığı Toz Şeker1 dolu yemek kaşığı Tereyağı1 paket Vanilin İçi için 1 kase dövülmüş Ceviz içi 💎Üzeri için 2 yemek kaşığı file Antep Fıstığı8 yarım Ceviz içi Kadayıfları elinizle minik parçalar haline getirin. Tereyağını tencerede eritin ve kadayıfları tencereye ilave edin. Kadayıflar altın rengi olana kadar kavurun. Kavrulan kadayıfları küçük boy fırın tepsinin tabanına bastırarak yayın. Her yeri eşit kalınlıkta olmalı. Bir tencerede sütü, şekeri, unu, vanilini ve tereyağını iyice karıştırıp ocağa alın. Göz göz kaynayıp muhallebi kıvamı alana kadar pişirin. Muhallebiyi oda ısısına gelene kadar yaklaşık 10 dakika çırpın. Ilınan muhallebiyi kadayıfların üzerine eşit şekilde yayın ve tepsiyi hafif sallayarak üzerini düzeltin. Soğuduktan sonra tatlıyı buzdolabında en az bir saat bekletin. İyice soğuyup katılaşan tatlıyı 8 eşit parça olacak şekilde kesin. Daha küçük dilimler olmasını isterseniz daha fazla parçaya bölebilirsiniz. Dilimlerin uç kısmına ceviz koyup spatula yardımıyla rulo yapın. Üzerini file fıstık ve cevizle süsleyip servis yapabilirsiniz. Afiyet olsun😘😍 kadayifkadayifsarmasimuhallebilikadayiftatlisinefislezzetletharikasunumlartariflerbloginstagraminstatariflerrenkkremalitatlilarpratiklezzetlersunumlarfistiklitatlikadayifsarmapaşatatlisi#


0💬Normal

Günaydın canlar hayırlı sabahlar günü aydın yapan güneşin doğuşu değil yüreğin umutlara uyanuşıdır yüreğinizdeki tüm umutların gerçekleşmesi dileğiyle mutlu keyifli huzurlu günleriniz olsun 🔹 Pazar kahvaltısı için yaptığımız gevrek #analikizlisunumlar sunumlar tarifler gevreksunumu ardahanyresi sunumnemli kesfet kesfetteyiz


17💬Normal

Günaydın 🌞 Kahvaltıya, uzun yolculuğa veya çay saatine gidebilecek haşhaşlı cevizli yumuşacık ekmek tarifiyle karşınızdayım. —————————————————- Malzemeler: •1 su bardağı yoğurt •1 su bardağı su •1 paket yaş maya •1/2 çay bardağı kadar fındık yağı •1 yumurta sarısı (üzeri için) •1 tatlı kaşığı tuz •3–4 bardak tam buğday unu ———————————————- İç Malzemeler: •1 çay bardağı haşhaş ezmesi •Yarım su bardağı sıvı yağ •1 çay bardağı kadar kırılmış ceviz ————————————————- Yapılışı: •Yoğurt ve su ılık ile beraber mayayı katıp karıştırın. •Kalan malzemeleri de ilave ederek yumuşak bir hamur elde edin ve üstünü iyice kapatıp sıcak bir yerde 1 saat dinlendirin (Antalya’da çok kolay oluyor🙈). •Haşhaş ezmesiyle ve fındık yağını da bir kapta karıştırın. •Dinlenmiş hamuru genişçe açarak haşhaş ezmesi ve bir parça koparın elinizle çok az açın arasına haşhaşlı karışımı hamurun içine yayın. •Büyükçe hamuru sarıp kıvırın ve kek kalıbına yerleştirin. •Hamurunuzun üzerine yumurta sarısı sürün ve dilerseniz susamda serpebilirsiniz. •190 derecede 20-25 dakika pişirin ve hazır 🤗. . . . . . . . . . healthyfood breakfast neverwithoutbreakfast eatwellbewell eatwellbecool goodmorning goodmorningpost blogger happy healing tastemade kahvaltiliktarifler kahvaltı muhtesemtarifler onlinetarifler tarifler foodporn glutensiz ekmekyapımı


4💬Normal


Next Page

#dinner - #recipes - #food - #keto

counter