#weightgain

😉


1💬Normal

The cost of human trafficking is not just the abuse of a body, but the poisoning of a soul. When the souls of our neighbors are mistreated in this way, the poison spreads through our culture, to families like Serrano’s who grieve the loss of a loved one they knew... What a Houston teen’s suicide teaches us about sex trafficking? Dallasnews.com/opinion/editorials Oct 21, 2019 sextrafficking houston texas leticiaserrano body soul hypertension weightgain sleeplessness emotionalabuse trauma emotionaltrauma kidnapped drugged rescued girl teen victim families parents community lessons grief griefjourney sexualabuse abused humantrafficking sextraffickingawareness


2💬Normal

Loving these cherry-lime la croix! Perfect drink when I want something fizzy! Paired great with my chicken salad 🍒🥗🍴 . . . WonderWrkouts weightloss weightgain weightlossjourney diet weight workout transformation healthyisthenewskinny positive bodypositive inspire motivation newme better betterme thick curvy plussize plus freshstart strong healthy salad lacroix delicious


0💬Normal

Are you pursuing fitness goals because you’re dissatisfied with yourself or because it’s something that you enjoy? For a long time, I went to the gym because I hated my body. I hated myself, and I wanted so desperately to change the way I looked that I punished myself at the gym every day. I kept achieving fitness and physique goals, and you know what? None of those things changed my opinion of myself. Reaching a point where you are satisfied and happy with who you are every day is NOT the same as a fitness journey. Work out because you love it, because you enjoy it, and not because you think reaching a certain physique goal will automatically give you love for yourself. If you’re dissatisfied with who you are or what you look like, the reason for that runs WAY DEEPER than what your body looks like. And figuring that out takes WORK. Reaching a physique won’t give you happiness/self love/mental peace - you need to work on that stuff every day. It won’t come “once I get thin”, or “once I get that job”, or “once I get that award”, etc. That has to come from within. Fitness is a beautiful thing, but it’s not solution to all your problems, and shouldn’t be treated as such. Work out because you love it and have fun, but don’t use it as a way to run away from working on your actual problems. - - - musclegain screwthescale weightgain weightlifting bbgprogress transformation weightloss foodisfuel girlswholift bbgcommunity fitspiration fitgirl fitnessmotivation bulking fitness cutting gymmotivation eatbetternotless womenwholift fitnessaddict fitnesstransformation edrecovery flexibledieting bodypositive bodybuilding weightlosstransformation mindset positivethoughts fitgirl


0💬Normal

Leticia Serrano was abducted and sold to sex traffickers. She was abused by multiple men. The ordeal lasted several days, and then she was rescued. Serrano did her best to live like a normal teenager, but the experience haunted her. Her parents said she couldn’t live with the pain. Our response must go further than laws and policies. The work doesn’t end with the physical rescue. What a Houston teen’s suicide teaches us about sex trafficking? Dallasnews.com/opinion/editorials Oct 21, 2019 sextrafficking houston texas leticiaserrano body soul hypertension weightgain sleeplessness emotionalabuse trauma emotionaltrauma kidnapped drugged rescued girl teen victim families parents community lessons grief griefjourney sexualabuse abused sextraffickingawareness


2💬Normal

Most health professionals attribute weight gain to slow metabolism, eating too much, too many carbs + not enough exercise! . Much to my surprise, I learned in this medicalmedium radio show that there is no such thing a fast or slow metabolism. The word, “metabolism” means that we are able to assimilate food and use it for energy AKA... that we’re alive. Secondly, it’s often not about expending more calories than we consume!! . These were made up in order for us to think that we have faulty bodies. . It also doesn’t exclude people with minimal fat on the outside of their bodies. Often enough, athletes who are “in shape,” die of heart attacks + strokes. Why? Being skinny doesn’t mean that something isn’t wrong internally! One can still have a fatty liver causing pressure on the heart. . The truth is, WEIGHT GAIN is directly related to our LIVER. . It’s not about eating too many carbs, being lazy or lacking self control. It’s not caused by hypothyroidism or PCOS (although these can be a sign of future weight gain). It isn’t about our genes either! This theory keeps us blinded and relying on the industries. . There is something else in the body that went astray before all of these... . Weight gain is caused by: 🦠pathogens/toxins that weigh our liver down. ✌🏻adrenaline. 🥩high animal protein diets. 💦edema (lymph builds up with pussy fluid from infections). . Many of us live in a state of stress with demands upon us, in addition to not eating well. When adrenaline is released, the liver soaks it up, gets saturated by it + gets damaged...a perfect storm for weight gain. . Why do some people find that they gain weight when they start to eat an abundance of fruit and vegetables? Their liver was already taxed long before and weight gain was always going to be inevitable regardless. . We can loose the weight by cleaning up the liver (by removing the metals and lessening our pathogens). . High protein diets not only kill the kidneys (which cannot handle protein), the liver + hurts the adrenals. If you have a diet high in fat (protein) + you don’t have a weight problem, that doesn’t mean it won’t happen down the road for the following reasons... 👇🏻👇🏻


2💬Normal

“aRe tHoSe sTeRoIdS” 🙃⁣⁣ ⁣⁣ The breakfast of CHAMPIONS🏆⁣⁣ *Well excluding the bacon Obviously 🙄 🥓 ⁣⁣ ⁣⁣ Anyway those are not steroids....to be honest I just placed them in this picture just for the sole purpose of making my Instagram persona look savage AF 😎⁣ HOWEVER, Don’t be fooled!! You may think the above suspicion tablets in the little innocent bag are harmless little guys but they can be used to kill off the guy/girl who is now always talking to your gym crush!! All you have to do is hand them the bag and ask them to try and swallow them, yes as easy as that‼️⁣ choke ⁣⁣ ⁣ Breakfast is controversial these days. Some “experts” say skipping breakfast is the trick to staying lean and healthy while others say it’s vital for preserving health and preventing weight gain. For me I take breakfast as for me personally it helps replenish energy lost during sleep so I can get the best out my day and helps get my calories in from the GET GO so I’m not stressing out at the end of day because I’m not close to my calorie intake goal because I decided to skip breakfast ✅ ⁣⁣ ✨Long story short if you are BULKing Up eat a LARGE Breakfast🥞✨⁣⁣ ⁣⁣ 2000cals is normally what I would take for my breakfast which helps me with my goal for bulking up. The above meal only takes 8 mins to make but 8 hours to eat (for me) soooooo I’ll make a post next on how to consume OVER 2000cals within 60seconds because I know ain’t nobody got time for that 🙌🏼⁣⁣ ⁣⁣ P.S I’ve missed this 😢 I’ve not had a breakfast over 300cals in over 2 months now lol hopefully I’ll be eating to bulk up again very soon ⏳⁣⁣ 90daytransformationvid comingsoon fakeinstagramperson imisspnutbutter


1💬Normal

"Alone we can do so little; together we can do so much." – Helen Keller 🔥 Our semi-private sessions are designed to help everyone reach their goals TOGETHER. It was proven that clients feel more motivated when training in a semi-private group than a one-on-one session due to the team spirit energy in the gym. What are you waiting for?! Come get your FREE consultation today to get started and join the Astrofit family!


1💬Normal

Each of us is a complex, interconnected system of body, soul, mind, will and spirit. Emotional trauma like grief, neglect or PTSD can manifest with physical symptoms like hypertension, sleeplessness or weight gain. What a Houston teen’s suicide teaches us about sex trafficking? Dallasnews.com/opinion/editorials Oct 21, 2019 sextrafficking houston texas leticiaserrano body soul hypertension weightgain sleeplessness emotionalabuse trauma emotionaltrauma kidnapped drugged rescued girl teen victim families parents community lessons grief griefjourney sexualabuse abused sextraffickingawareness


2💬Normal

Magic Menopause weight loss pill?? . . . . . . . . . . . spoileralert it doesn’t exist - but there is a solution. When the menopause hit my body it was a shock to the system - quite literally. Forget the mood swings, the hot flashes, the memory issues, the brain freeze, the aching joints, the lack of sleep- the list goes on and on. But the 2 biggies for me were weight gain and loss of strength. I had spent most of my adult life active and fit and healthy and suddenly I felt like I was dying of some mysterious illness. So I searched for the magic pill, don’t we all try to find the easiest solution, or is that just me? Then when I realised there isn’t a magic pill I wondered if it was time for me to just “settle”. To accept getting fatter and weaker and just looking older? Well HELL NO! I wasn’t ready for the rocking chair and the knitting lol and Im guessing neither are you. So if you want to know how I lost 56 pounds of weight and got stronger and fitter and lost ALL my menopause symptoms than in my 30s drop me a 💪 in the comments . . . . . . menopause weightgain menopausesymptoms fitnessjustforyou transformation magicpill fatloss weightlossjustforyou weightlosstips hormones midlifewomen womenshealth strenghtraining cardio nutritionmatters thereisasolution fitatfifty strongatfifty menopauseweightloss fatlossworkouts changeyourlife dontsettle liveyourbestlifenow onlinecoach over50weightloss perimnopauseweightgain weightlossforwomen


0💬Normal

Reminiscing. Me getting ready to stomp on my favourite Irish gal with cat makeup on. I wish I had more pictures of me at this weight. bulimiarecovery bingeeatingproblems blurrypic weightgain


0💬Normal

El Capo... LaFamilia


2💬Normal

Nuts May Lower Risk of Fatal Heart Attack and Stroke. Over the course of a twelve-year study involving 5,432 adults, researchers observed that participants who ate nuts at least twice a week had a 17% reduced risk of death from cardiovascular disease. Study author Dr. Noushin Mohammadifard explains, “Nuts are a good source of unsaturated fat and contain little saturated fat… They also have protein, minerals, vitamins, fiber, phytosterols, and polyphenols which benefit heart health.” Nut Consumption Linked to Less Weight Gain and Reduced Obesity Risk. According to a study that analyzed data collected from nearly 290,000 adults, there’s an association between daily nut intake and a reduced risk for long-term weight gain. BMJ Nutrition, Prevention & Health, September 2019 European Society of Cardiology, August 2019 painrelief backpain neckpain backpainrelief neckpainrelief headaches migraines convenient affordable midbackpain radiculopathy manipulation feelbetter drgregoryangermaier suburbanchiropractic newarkdelaware beardelaware ChiroTrust nuts heartattack stroke cardiovasculardisease metabolicdisease unsaturatedfat obesity overweight weightgain


0💬Normal

🔥Muscle Gain and Weight Loss Meals 🔥 ➖➖➖➖➖ 👉 Follow gymtricks0 👉 Follow gymtricks0 👉 Follow gymtricks0 . . Credits:equalution 5min_healthy ! ➖➖➖➖ ➖


1💬Normal

Are you struggling with gaining weight⁉️ Get your Apetamin Vitamins and syrup. •link in our bio •754-240-1891 Shipment 3-5 Days priority USPS _______________________________________ • naturally_curves • Apetamin will increases your appetite enabling you too eat more which will result in weight gain. * Let The Gains Begin * Weight Gains All 2019 Apetamin Syrup weightgain tablets Booty gainz getthick naturally fitness gym shopapetamin womenhealth shopapetaminhere getfine apetaminworks cheapapetamin apetaminsale miam florida fast results dm # usexploresfsviral#


0💬Normal

my favorite human. 💛


2💬Normal

rogerio_weightlifting Pouco a pouco na raça e força de vontade agente vai melhorando 🏋️🎖️🔥 Double Snatch 160kg 🏋️ TUDO POSSO NAQUELE QUE ME FORTALECE JESUS 🙇🏋️ crossfitselecao  welisson_weightlifting  coachhoracio  rreisfernando bbewareoficial  dr.joaquimmenezes  proven.pb  bravourbrazil hamiltondefreitas37  lpo.pinheiros  emerson_lpo_brasil ecpinheiros  @_vitoriarodriguess  3b_industriafitness crosshopbrasil  tina_reuter_camargo  poweroficial  marceloaraujodp  insta.gyurko weightliftingbrasil lpobrasil powerliftingbrasilpowerlifters crossfiters levantamentodepesocrossfitbrasil crossfit crossfiter crossfittercrossfitcommunity crossfitoficialcrossfitmotivation crossfittrainingcrossfitathlete crossfitmen crossfitopen emerson_lpo_brasil 🇧🇷 crossfiteiros lpo weightgainweightlifting weightloss olympicweightliftingweightliftingmotivation snatch cleanandjerkworkout


0💬Normal

At the end of the day, it’s all about being happier with who you’re becoming. AstrofitChallenge


2💬Normal

Repost Hey! It’s Allison! Back at the gym after 7 years. I don’t remember it being this hard! But life is hard. I have to work through the pain in order to KeepMovingForward and of course always RockinWellness too! Save 10% off your entire order. Use code: ROCKINALI superfoodnutrition vegan weightgain yesIcan shake protein transformation exercise workoutTransformation. GettingInShape fitandskinny fit fitness skinnyfat smoothies


0💬Normal

Not even the heaviest things but felt good regardless as Life is hectic right now. All in the same workout - 77.5kg OHP, 125kgX5 pendlay barbell row, 60kg weighted dips X4. BW 76kg • • • • powerlifting powerbuilding weightgain weightloss fitnessmotivation weightloss weighlifting running cardio squat squats ohp rows pullups pullup back backworkout overheadpress benchpress motivation discipline


0💬Normal

🚨LEG DAY🚨⁣ “Don’t be upset by the results YOU didn’t get with the work YOU DIDN’T do” Get better today.⁣ ⁣ ⚫️4x6 FRONT SQUATS (275-285 lbs)⁣ ⁣ ⁣ ⁣ ⁣ 🔴 4x8 HACK SQUATS⁣ ⁣ ⁣ ⁣ ⚫️4x15 SEATED HAMSTRING CURLS⁣ ⁣ ⁣ ⁣ 🔴4x10 LUNGES ⁣ ⁣ ⁣ ⁣ ⚫️2xAMRAP LEG EXTENSIONS⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ➖➖➖➖➖➖➖➖➖➖⁣ Save ✅ and Follow⁣ chicken_williams👈🏿⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ⁣ ________________⁣ mealplan motivation athlete determination bodybuilding transformation healthiswealth bodypositive physique frontsquats grind weightlifting lunges hypertrophy crunch gym austinfitness atxfitness lifting gymrat weightloss weightgain strengthandconditioning muscles fitnessconnection deadlift fitnessmotivation upperbody back squat


41💬Normal

It’s a lot of talk about chia seeds and specifically for people who want to lose weight. But they actually work for us ladies that want to gain too! Why? Because they’re a great way to add in extra calories without more meals. Chia seeds are among the healthiest foods on the planet. They’re loaded with nutrients that can have important benefits for your body and brain. Have you used chia seeds in your meal before?


3💬Normal


5💬Normal

HappyGains to everyone! Good luck with your weight gain journey! 💚🌱⁠ .⁠ We are still in stock with the following supplements: ⁠ ✳️ SuperBody- Appetite Enhancer⁠ ✳️ EatUP Curves- Weight Gainer/Lower body Gains⁠ ✳️ EatUP Plus- Best Paired with EATUP original to help boost ⁠ . ⁠ Both EatUP Supplements include a meal & workout plan💪.⁠ .⁠ ⁠ healthy gainweight health slimthick protein thick gainingweight getyoweightup gains vitamins ct eatmore weightgain bodybuilding gym fixit goalweight gainmore eatmore ensureplus thin badappetite gains achieve supplements fitness nutrition appetiteenhancer


4💬Normal

Weighed in yesterday for the first time in months and I'm 5kg heavier than I was in April. The old Laura would've lost the bloody plot at that news, but to be honest I'm not too phased. Yes, I could clean up and reign in my weekend splurges which have no doubt contributed to the increase - but more importantly, I have been working my ass off to build strength, up my weights and increase my muscle mass which I know very well has also contributed to my weight gain on the scales. Bottom line is, the number you read between your feet doesn't define you as a person or measure your worth. I was telling shit dad jokes 5kg ago and I will continue to tell them noe. weights strength weighttraining strengthtraining strong fitness gym gymlife motivate motivation fitnessmotivation workout gymgirls curvy curvygymgirls curvygirls personaltrainer progress weightgain buildmuscle booty bootyworkout


0💬Normal

Side Booty Burner 🔥 . 1️⃣ Glute push down crossovers 5 sets of 8 each side, increasing weight each set . 2️⃣ Single leg leg press pulses 5 sets of 5 w/ 5 pulses at the bottom, increasing weight each set . 3️⃣ Kneeling abductors 5 sets of 10, increasing weight each set . 4️⃣ Abductor variation 5 sets of 8 laying back and 8 leaning forwards, increasing weight each set . . . . . . . . . . . . . . . . . . . . . . physique physiquecompetitor bodybuilding bodybuilder glutepushdowns girlswholift buildabooty gymshark gymsharkwomen vans iworkoutinvans sisel siselript fitnessmorivation weightgain gainz fitchick motivation motivational backday glutes summershread hamystrings hipbridges lunges legs bulking bulkingseason hamstringworkout


8💬Normal

So after I did my first rep, I paused a little because I had NO idea this was gonna hurt so badly LOL but man this exercise was so effective!!! hardbodydriqq got all the heat in this weight gain plan😩😩👏🏽 fueledbyherbalife teamhardbody lawrenloveslegs weightgain upperbody heat 🔥


2💬Normal

WORLDWIDE MASKUPBOYZ 👺🌏👺 Maskup and tag us! . . Posted withrepostpyro_fit_royalty Use your reflection as competition, motivation and mold it into your own workouts...Let’s get this Arm Workout going!!!! itworks maskon gymmotivation shreddedacademy faceyourfears faceyourself bodybuilding leanmuscle lifetimefitness muscle armworkout strengthworkout hustleforthatmuscle weightgain peloton pelotongear elevationmask elevationtrainingmask armday blackfitness trainingmask saturdaymotivation trainingmask3 maskupboyz


1💬Normal

When you put your head down and all you notice is under the chin fat! 👀😢🤦‍♀️. How did this happen?! Why yes all of those krimpets, pecan cinnamon swirls, yellow cake with butter cream icing, and those family size pack of oreos. That stuff be so delicious they are empty calories with no nutritional value. chinfat weightlossgoal weightlossstruggles weightlossstruggle foodtasty weightgain weightloss weightlossjourney2019 thestruggleisreal fatlosstips weightlossinprogress


0💬Normal

Mon petit finish pour le dos, enchaînement des 2 mouvements sans repos. Dernière série à l'échec, rincé... instagram men body gainz weightgain motivation insta hard love gym classicphysique workout muscle backday strong bulk iron bodybuilding training aesthetic lifestyle oldschool sports fitness #fitfam instapic fitnessfrance fitguy fitnesspark fitnessparkcharleville


1💬Normal

Less than a month to go until I get a second chance of life. I’ve never been skinny in my adult life. The last time I was a normal weight, I was in elementary school. Maybe 2nd or 3rd grade... and of course I don’t remember that. I do remember being the fat girl in 4th and 5th grade, and the rest of my life. I don’t know what I’ll do with myself when I’m under 200 lbs... or when I’m at goal weight. Which speaking of... I think I want to get to 150 and then decide if I like that weight or to lose more. At 150 my BMI will technically still be overweight but I guess that’s better than obese. 🙃 weightlosssurgery rny rnygastricbypasssurgery rnygastricbypass gastricbypass rnycommunity wlscommunity wls wlssupport weightloss weightlosstransformation weightlossjourney gym goaldigger workoutmotivation workingout weightlossquotes weightgain losingweight notgivingup pcos lowcarb cookeville cookevilletn


0💬Normal

Premera Health Insurance provides a free Fitbit to some of their members (probably depends on what plan you are on). . . I am far from involved in fitness, but this little thing really puts my health into perspective and I love it. 😍 . . Ring for attention 💍 . . fitbit h20 healthydiet sleeppattern live love well bestyou youarethebest takecareofyourself health steps caloriecounting caloriesincaloriesout diet weightloss weightgain


0💬Normal

[You were not BORN with an inner critic.] . Sometimes maybe you really DO want to expand and get out of your comfort zone. . However, you crave change and want it SO DAMN bad, but you just can't help the negative thoughts in your head from telling you that maybe you aren't worth it, or that you don't even deserve it. . My question for you is, why is it so hard for us to turn those negative voices OFF and to follow our own dreams in life? . We need to learn how to shut down those inner negative voices and replace them with positive ones as soon as they happen. I read something recently about having negative voices and your own inner critic. . 🚨You were not BORN with an inner critic. . Your inner critic was basically born from what others EXPECT you to be, and what the outside world's standards are. . 🚨It's NOT you. . Once we can learn that, and learn how to block all of those shitty thoughts out, we'll be that much closer to reaching our goals/dreams.🚀🌈💕 . ---- ⚡️1:1 Coaching - 👉🏼APPLY TODAY - link in bio 📒12TOFIT Program - Link in Bio📘 ---- . throwback humpday workoutvideos bikinibody fittips workoutsforwomen shreddingforthewedding workouttips buckedupsupps workoutinspo payitforward trainertips onlinehealthcoach lifestylefitness reversedieting weightgain fitaf NHFWORKOUTS 12TOFIT 2020isMyYear 2019IsMyYear fuckfear goalcrusher goals hydrojug


4💬Normal

🚨🚨SALE $9.99 click the link to purchase! naturally_curves Are you struggling with gaining weight⁉️ Get your Apetamin Vitamins and syrup. •link in our bio •754-240-1891 Shipment 3-5 Days priority USPS _______________________________________ • • Apetamin will increases your appetite enabling you too eat more which will result in weight gain. * Let The Gains Begin * Weight Gains All 2019 Apetamin Syrup weightgain tablets Booty gainz getthick naturally fitness gym shopapetamin womenhealth shopapetaminhere getfine apetaminworks cheapapetamin apetaminsale miam florida fast results dm # usexploresfsviral#


0💬Normal

Damn she's not even the size of one tiddy. Imagine how soft she'd be though bbw ssbbw weightgain fat fatanime feederism feedism feeder feedee


0💬Normal

Holidays are approaching fast don’t be the person gaining 10-15lbs. Hit me up for your fitness needs!!! Weight Loss/Weight Gain. —— ➖ 4 Exercise circuit| No weights needed | 1️⃣Plank Reach 2️⃣Cross Body Mtn Climbers 3️⃣Plank Raise 4️⃣Skip Sprints in Place ⏰ 40Sec exercise 20Sec Rest —— ➖ | ↔️SWIPE LEFT 🔄SAVE FOR LATER ⏯ DO THESE AT HOME 💻 {TAG YOUR WORKOUT PARTNER} . . . View My Stories Ebook 📚 Now Available The Weight Gain BluePrint Dm me to reach your fitness goals . . . weightloss fatloss exercise slimthick booty abs transformation mindset shift onlinefitness cutthefatp cutthefatnow hiit weightgain


0💬Normal

I’m probably the heaviest I have ever been in 10 years ( I was almost obese prior to ED). I’m seeing stretch marks, cellulite and I am not ready. Today, I looked at my reflection in the mirror and I did not recognise myself. As I told in other posts, people know me as the Tall skinny girl with perfect skin. Today I’m just overweight and to top it all I had an allergic reaction to some food I had and my face is covered with small red spots. and I can’t believe this is happening to me. I knew for sure that I was going to put on some weight but I wasn’t really prepared psychologically. Yes it hurts Yes I cried all my tears Yes ED voice came back.. Bit Im not going back. I’m not going back after 8months of starting recovery. I will fight and survive this. Edit: I do not want to offend anyone, I’m just sharing the thoughts that go through my head as I try to cope with weight gain. The worst thing is that I absolutely adore seing a curvy woman, I think most of my crushes are curvy girls but the paradox of not loving myself with curves perhaps resides in the fact that I was bullied in my childhood and preteens for my weight, and apparently I still didn’t get past that trauma. / / / / edrecovery recoverywarrior bulimiarecovery dysmorphiaboulimie guerirdelaboulimie dysmorphie muslimwithed bodydysmorphia intuitiveeating nodiet reversediet dietsucks warrior recovery mentalhealth strong ana mia bulimianervosa recoveryjournal weightgain


1💬Normal

On peut faire des choses difficiles! Il ne nous reste plus qu’à commencer🔐 n’attendez pas demain ou jusqu’à ce que vous êtes {prêt}!!! Mettez un pied devant l’autre. Soyez résistant et rappelez-vous tous les jours pourquoi vous faites ça 📍 la cohérence 🔜 progrès s’ajoutent et nous montre la grande photo 🔛😍💪🏼✅ . . . ——.✨ workoutathome fullmoon weightlosstransformation weightlossjourney musclegirl yoga motivation pertedepoids strongbyzumba cardio musculationfemme weightgain newlifestyle sportmotivation fitmom fitbelgium determination myprotein #يوگا #زومبا #رياضة basicfitbe basicfitfr #شد الجسم #رياضة #رياضة_نساء #رياضة_تحفيز #رياضة_تايم #تغدية #رياضة_منزلية


2💬Normal

So your probably wondering how I ended up here, well if I'm going to tell you it would have to be fron the beginning... skinny weightgain chunk skeleton needfood fitness motivation health healthylifestyle weightgainjourney nutrition fat


0💬Normal

Today I was feeling very sad and tired but then God’s passage I shared on my last post hit me hard. This recovery journey is very emotional draining because you have to constantly tell yourself everything is OK and constantly fight against Ed thoughts. Remember you can always rest and find comfort in God’s arms because He is there with you all the way. You are not alone! . After pizza I had this plate of sweets. I got this butter cookie I always wanted to try but never bought it because of the word butter! But now I don’t mind 🤷‍♀️ . . . . . . edrecovery eatingdisorderrecovery eatingdisorderecovery allin bingeeating binge compulsiveeating anorexianervosarecovery bulimiarecovery eatingdisorder weightgain gainingweightiscool foodaddictionrecovery foodaddiction bodyimage learntoloveyourself feelgood lovemybody weightgain weightgainjourney bingerecovery bodyacceptance fearfoodchallenge allin


1💬Normal

Bad sleeping habits? Think restful weekends are enough? Your lack of sleep could be why all your great dieting efforts aren't working. 😴 sleeplessnights weightgain getsomerest https://zcu.io/Wk3o


0💬Normal

rivalus whey and clean gainer restocked now at Arena Supplements! rivalus protein weightgain supplements


0💬Normal

Wednesday Weigh In..⠀ ⠀ So this week has been a half pound gain. I’m not really sure where this has come from but knowing last week I’d been poorly and not had much appetite, I’m hoping it’s come from this as I’ve now got my appetite back.⠀ ⠀ But..... I’m going to look past this aim to lose 1.5 lbs next week. Setting goals keep me focused 💖⠀ ⠀ goalsetting wednesdayweighin weightgain weightlossjourney slimmingworld slimdown weddinggoal


0💬Normal

Do you need bioidentical hormone replacement therapy? drnathanthomas estrogen progesterone testosterone hormonebalance hormoneimbalance weightgain chronicfatigue


0💬Normal

We are going AGAIN in November... Private group fitness class, for all fitness levels, all ages, absolutely EVERYONE is welcome to join us. We have limited spaces so get in there quick. Date to follow - Are you coming? This lot smashed the last session, fitness for everyone 💪🏼💚 ———————————————————————————- fitness f45 f45chelmsford health fitnessmotivation fitgirls fitboys weights bodyweightworkout herbalifenutritioncoaches fun healthylifestyle f45fitness teamtraining dannisbodygoals globalresultsteam weightloss weightgain nutrition lifestyle workoutwednesday


6💬Normal

. THE COUNTDOWN HAS BEGUN 🎉🎉🎉. REGISTRATION CLOSES THIS FRIDAY!! WHO'S EXCITED AND CAN'T WAIT TO FINALLY START FITTING INTO THOSE CLOTHES YOU'D LOST ALL HOPE OF EVER WEARING, GLOW AND HAVE A NEW SPRING IN THEIR STEPS?🥰🥰🥰. SECURE YOUR SLOTS NOW!!! . . Are you looking to kickstart your weight loss journey, get rid of bad food habits, break free from health conditions like INSOMNIA, HBP, MIGRAINES etc while also LOSING INCHES OF YOUR WAISTLINE thereby finally crossing out “lose weight” from your new year list?? 💃🏽💃🏽 We have the package to do just that!! FAT, PACK AND GO!! This package will consist of; . . 👏🏾 Meal plan to lose inches on your waistline and accelerated fat loss. . . 👏🏾 Detox plan to get rid of toxins . . 👏🏾 ANNIVERSARY DETOX GIFT BOX 🥳🥳 . . 👏🏾 Daily tips and tricks to help you achieve weight loss, relieve bloating and constipation. . . 👏🏾 Tips to manage health conditions such as high blood pressure, insomnia, migraines etc . . 👏🏾Easy to do indoor exercise routines (No gym required) . . 👏🏾Access to Coach Damz via THE WHATSAPP GROUP CHAT ONLY for strict monitoring and accountability. . . 👏🏾Weekly weigh ins and updates via food journals, tape measurements and digital scales. . . Come one, come all!! This bootcamp promises to be mind blowing, tell a friend to tell a friend, you don’t want to miss this 🙌🏾🙌🏾. . . . askdamz askdamzweightloss Fitnesslifestyle weightloss healthylife liveright Nigerians weightlossinspiration womenshealth menshealth inspiration fitspiration healthcoach nigerianwomen naijabrandchick blackweightloss askdamzhealthylifestyle slimmingworld weightwatchers Naijafitness healthylifestyle weightgain blackhistory fitfam weightlossjourney


9💬Normal

Baby steps and tortoise attitude. Most people on a weight loss journey want results yesterday. I was 'most people'. I tried every short-cut going. The weight came off. The weight went back on again - plus some!. I finally released the weight by taking baby steps and adopting a tortoise mentality. Slow was OK! The weight has stayed off now for more than five years. Finally I am able to stop identifying as a human yo yo! This journey was not a linear one and it was taken in the slow lane with baby steps. I watched so many people zoom by in the weight-loss fast lane. The ones who reached their goal weight super quickly - through crash diets and restriction- invariably ended up right back at the starting line again carrying extra 'luggage'. Practising mindfulness helped me to accept myself at each stage of the journey and to hold on to desire for a goal weight with a light touch. You CAN have goals AND practise mindfulness at the same time! The key is to avoid being too attached to the outcome. This can seem to be counterintuitive initially, but believe me, it works. mindfuleating mindfulness tortiose babysteps slowandsteady beforeandafterweightloss weightlossjourney bingeeatingdisorder cravings wlcommunity goalweight keeptheweightoff 100poundsoff extremeweightloss weightgain goalweight weightlossgoals transformation weightlosstransformation consistencyiskey keepgoing yesyoucan diet myweightlossjourney onelifeshowup obesetobeastjourney


0💬Normal

2. I like this picture because you can see my acne and my tummy. And because you can obviously tell how much my partner loves me and how much I love ice cream. Since beginning my medication regimen, my depression has been curved significantly as well as my anxiety, although I do hope that I am able one day to be prescription med free. I’m currently prescribed Celexa. While the meds help a lot, I still do have ups and downs. Today I have a bout of anxiety. My therapist told me to try to take note of what thoughts cross my mind when I get anxious. Today, I am worried about us going out of town this weekend and I always want everything to be perfect and I fear that my anxiety will get in the way of me having fun, so I give myself pre-anxiety by worrying before I even get there 🙃 if you’re struggling today or have something specific that initiates the anxiety and want to share, comment below anxiety depression mentalhealth mentalhealthawareness weightgain storytime


0💬Normal

Le triceps est un des muscles avec lequel j’ai de très bonnes sensations ! Je le trouve tellement beau 🙌🏾💪🏾 Ça rappelle un peu la forme d’un fer à cheval🐴 musculation armsday tricepsworkout triceps tricepstraining tricepsday armsworkout arms shape pumped nopainnogain bulking weightgain workout training exercise bodybuilding motivation fitness fitnessmotivation gym work fitfrenchies FF instafollow follow4follow followback instapic instamoment frenchriviera


11💬Normal

🍑 All About The Glutes 🍑 Alright fit fam! It's been a minute since I last posted because you know life 😄 So let's get back to biz with this awesome glute burn🔥 ******************* 1️⃣Kneeling kickbacks x each side 2️⃣Banded reverse hypers 3️⃣Elevated glute bridges 4️⃣Seated hip abduction 5️⃣Side plank abductions ▶️10 reps x 4 sets w 5min rest between circuits ******************* 🎶Haze M - House Music (original mix)🎶


6💬Normal


Next Page

#dinner - #recipes - #food - #keto

counter